Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7Z5U6

Protein Details
Accession R7Z5U6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
30-49GESWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
12-52KKRTAPFKRHQSDRFMRVGESWRKPKGIDNRVRRRFKGQAA
Subcellular Location(s) mito 18, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHITIVKKRTAPFKRHQSDRFMRVGESWRKPKGIDNRVRRRFKGQAAMPKIGYGSNKRTRHMMPSGHKAFLVNNIRDVDLLLMHNRTHAAEISHAVSSRKRIEIIARAKQLGVKVTNGKAKVTTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.71
3 0.72
4 0.72
5 0.75
6 0.74
7 0.77
8 0.78
9 0.77
10 0.77
11 0.75
12 0.7
13 0.6
14 0.52
15 0.45
16 0.49
17 0.48
18 0.48
19 0.48
20 0.46
21 0.46
22 0.46
23 0.51
24 0.53
25 0.54
26 0.56
27 0.6
28 0.68
29 0.77
30 0.82
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.58
37 0.58
38 0.57
39 0.57
40 0.5
41 0.43
42 0.38
43 0.3
44 0.27
45 0.21
46 0.24
47 0.31
48 0.33
49 0.34
50 0.37
51 0.37
52 0.4
53 0.41
54 0.4
55 0.35
56 0.43
57 0.45
58 0.42
59 0.4
60 0.35
61 0.3
62 0.31
63 0.33
64 0.24
65 0.24
66 0.25
67 0.25
68 0.24
69 0.24
70 0.16
71 0.1
72 0.1
73 0.09
74 0.09
75 0.09
76 0.1
77 0.1
78 0.1
79 0.1
80 0.1
81 0.1
82 0.1
83 0.12
84 0.13
85 0.14
86 0.15
87 0.15
88 0.16
89 0.2
90 0.23
91 0.23
92 0.22
93 0.23
94 0.28
95 0.36
96 0.43
97 0.46
98 0.46
99 0.45
100 0.45
101 0.45
102 0.42
103 0.38
104 0.32
105 0.28
106 0.31
107 0.36
108 0.42
109 0.41
110 0.4
111 0.37