Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YLU2

Protein Details
Accession R7YLU2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
25-48LSLLPAYRPRPRPKLRGTPTRLLIHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, plas 4, mito 3, E.R. 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013969  Oligosacch_biosynth_Alg14  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0031965  C:nuclear membrane  
GO:0006488  P:dolichol-linked oligosaccharide biosynthetic process  
Pfam View protein in Pfam  
PF08660  Alg14  
Amino Acid Sequences MPTPLHTTLLTLLLLLIPLTTLRILSLLPAYRPRPRPKLRGTPTRLLIVLGSGGHTAEMFALLRDLDTEKYNWRSYIVGEGDRFSAARAEEFERGLSERARAQATRTRRKNGALEGEKAEQAHAHTQQGSREAEEETQGYGGYDVYTIPRARAIHQPLSTTPLSALRCLLACFAVLLRAPNAERGPPDLILTNGPGTGVVVVLASLILRFLGVGQDRMRTVYVESWARVKGLSLSGRLLVRVVDRVLVQWEGLEGVGGRGEFLGVLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.06
4 0.04
5 0.04
6 0.06
7 0.06
8 0.05
9 0.06
10 0.06
11 0.06
12 0.08
13 0.13
14 0.14
15 0.17
16 0.24
17 0.29
18 0.37
19 0.46
20 0.53
21 0.59
22 0.66
23 0.73
24 0.75
25 0.82
26 0.83
27 0.85
28 0.84
29 0.82
30 0.76
31 0.7
32 0.6
33 0.5
34 0.4
35 0.3
36 0.23
37 0.14
38 0.12
39 0.08
40 0.08
41 0.07
42 0.07
43 0.06
44 0.05
45 0.06
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.06
52 0.08
53 0.08
54 0.1
55 0.11
56 0.16
57 0.21
58 0.23
59 0.22
60 0.22
61 0.21
62 0.21
63 0.27
64 0.24
65 0.23
66 0.22
67 0.22
68 0.22
69 0.21
70 0.2
71 0.13
72 0.12
73 0.09
74 0.09
75 0.11
76 0.13
77 0.14
78 0.14
79 0.14
80 0.13
81 0.14
82 0.15
83 0.13
84 0.12
85 0.13
86 0.15
87 0.17
88 0.16
89 0.18
90 0.23
91 0.32
92 0.41
93 0.45
94 0.48
95 0.48
96 0.52
97 0.53
98 0.51
99 0.52
100 0.45
101 0.42
102 0.4
103 0.39
104 0.35
105 0.31
106 0.26
107 0.16
108 0.14
109 0.14
110 0.12
111 0.12
112 0.13
113 0.14
114 0.15
115 0.19
116 0.18
117 0.15
118 0.14
119 0.14
120 0.13
121 0.12
122 0.12
123 0.08
124 0.07
125 0.07
126 0.06
127 0.05
128 0.05
129 0.04
130 0.04
131 0.04
132 0.04
133 0.08
134 0.08
135 0.08
136 0.11
137 0.11
138 0.14
139 0.21
140 0.26
141 0.29
142 0.3
143 0.32
144 0.29
145 0.34
146 0.31
147 0.24
148 0.19
149 0.18
150 0.18
151 0.17
152 0.16
153 0.12
154 0.13
155 0.13
156 0.13
157 0.07
158 0.07
159 0.06
160 0.06
161 0.07
162 0.07
163 0.07
164 0.07
165 0.09
166 0.09
167 0.13
168 0.14
169 0.14
170 0.14
171 0.17
172 0.19
173 0.17
174 0.18
175 0.15
176 0.15
177 0.15
178 0.15
179 0.12
180 0.1
181 0.09
182 0.08
183 0.07
184 0.06
185 0.05
186 0.04
187 0.03
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.02
195 0.02
196 0.03
197 0.03
198 0.07
199 0.08
200 0.12
201 0.13
202 0.16
203 0.17
204 0.19
205 0.19
206 0.16
207 0.17
208 0.16
209 0.21
210 0.22
211 0.22
212 0.24
213 0.24
214 0.24
215 0.22
216 0.19
217 0.17
218 0.2
219 0.22
220 0.21
221 0.22
222 0.25
223 0.26
224 0.25
225 0.23
226 0.18
227 0.16
228 0.17
229 0.16
230 0.14
231 0.14
232 0.15
233 0.18
234 0.17
235 0.15
236 0.12
237 0.11
238 0.1
239 0.1
240 0.09
241 0.06
242 0.06
243 0.08
244 0.07
245 0.07
246 0.07
247 0.07