Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7Z5R4

Protein Details
Accession R7Z5R4    Localization Confidence High Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
321-342DVAPRKNRRGQRARQQLWEKKFHydrophilic
NLS Segment(s)
PositionSequence
48-49KG
51-58ERQKLGRR
325-350RKNRRGQRARQQLWEKKFGGRAKHLQ
367-370KRGA
373-385PGDKRFGQRRTGK
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037393  Bud22/SRFB1  
IPR015158  Bud22_dom  
Pfam View protein in Pfam  
PF09073  BUD22  
Amino Acid Sequences MPKRKRSEFGGCTTQSLTDGPINARQYRVEHKINHGKKLLNRMLKLAKGFERQKLGRRHKTASQNGDVPGLARIDAEIEALKKLDIADAAETYLHKTLLKIKTIAASPSLPASVKLPSKAPPDTPTANVTARLYNANPVKETLGDILSDIRNALGVEQAGEAGRKDATKTGASERNHAKSRLEDVQQGASSESVSASSAGKKEEVECAYSDEFSDPASEDFAHLDARVAGSSTEESDEDSEEASVRSELPLASARGHDPVDDLSLTPSAFSLSSQSPEPESKAFVSKAAANAKKTSTFLPSLTMGGYWSGSESLPSDEEVDVAPRKNRRGQRARQQLWEKKFGGRAKHLQNKDAAGNGSRNEGWDPKRGAQVPGDKRFGQRRTGKHTVPDAKRRSEGNAISANGVDLNPSRQVKRDDQGPLHPSWEAAKQRKEQRVTAPFQGKKVVFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.37
3 0.31
4 0.26
5 0.19
6 0.21
7 0.21
8 0.26
9 0.3
10 0.31
11 0.32
12 0.32
13 0.34
14 0.39
15 0.45
16 0.46
17 0.46
18 0.54
19 0.63
20 0.66
21 0.69
22 0.66
23 0.65
24 0.62
25 0.69
26 0.67
27 0.65
28 0.6
29 0.6
30 0.61
31 0.59
32 0.57
33 0.52
34 0.49
35 0.5
36 0.54
37 0.52
38 0.55
39 0.55
40 0.61
41 0.66
42 0.7
43 0.71
44 0.73
45 0.73
46 0.72
47 0.78
48 0.79
49 0.77
50 0.72
51 0.66
52 0.61
53 0.56
54 0.48
55 0.38
56 0.3
57 0.22
58 0.15
59 0.1
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.09
66 0.1
67 0.1
68 0.1
69 0.09
70 0.09
71 0.09
72 0.09
73 0.09
74 0.1
75 0.1
76 0.11
77 0.11
78 0.11
79 0.12
80 0.13
81 0.12
82 0.1
83 0.11
84 0.2
85 0.25
86 0.28
87 0.27
88 0.27
89 0.31
90 0.33
91 0.33
92 0.26
93 0.22
94 0.19
95 0.19
96 0.19
97 0.14
98 0.13
99 0.13
100 0.16
101 0.18
102 0.19
103 0.2
104 0.23
105 0.29
106 0.31
107 0.32
108 0.3
109 0.34
110 0.35
111 0.35
112 0.32
113 0.31
114 0.29
115 0.28
116 0.26
117 0.22
118 0.2
119 0.2
120 0.18
121 0.21
122 0.24
123 0.23
124 0.23
125 0.23
126 0.22
127 0.2
128 0.21
129 0.16
130 0.12
131 0.11
132 0.1
133 0.12
134 0.11
135 0.11
136 0.09
137 0.08
138 0.08
139 0.07
140 0.07
141 0.06
142 0.05
143 0.06
144 0.06
145 0.07
146 0.06
147 0.07
148 0.06
149 0.06
150 0.07
151 0.07
152 0.07
153 0.1
154 0.12
155 0.14
156 0.16
157 0.21
158 0.28
159 0.28
160 0.35
161 0.38
162 0.42
163 0.44
164 0.43
165 0.38
166 0.33
167 0.37
168 0.37
169 0.33
170 0.29
171 0.27
172 0.29
173 0.28
174 0.26
175 0.2
176 0.14
177 0.12
178 0.1
179 0.08
180 0.05
181 0.05
182 0.05
183 0.06
184 0.08
185 0.09
186 0.09
187 0.1
188 0.1
189 0.11
190 0.15
191 0.15
192 0.15
193 0.14
194 0.17
195 0.16
196 0.16
197 0.15
198 0.11
199 0.1
200 0.08
201 0.09
202 0.06
203 0.06
204 0.06
205 0.06
206 0.06
207 0.06
208 0.07
209 0.06
210 0.06
211 0.06
212 0.05
213 0.05
214 0.05
215 0.05
216 0.04
217 0.05
218 0.05
219 0.05
220 0.06
221 0.06
222 0.06
223 0.06
224 0.07
225 0.07
226 0.06
227 0.06
228 0.06
229 0.06
230 0.06
231 0.05
232 0.05
233 0.05
234 0.05
235 0.05
236 0.06
237 0.09
238 0.09
239 0.1
240 0.11
241 0.11
242 0.13
243 0.13
244 0.12
245 0.1
246 0.09
247 0.1
248 0.09
249 0.09
250 0.08
251 0.08
252 0.08
253 0.07
254 0.07
255 0.06
256 0.06
257 0.06
258 0.08
259 0.08
260 0.1
261 0.11
262 0.12
263 0.13
264 0.14
265 0.16
266 0.14
267 0.15
268 0.15
269 0.18
270 0.18
271 0.16
272 0.17
273 0.16
274 0.21
275 0.27
276 0.29
277 0.28
278 0.3
279 0.3
280 0.31
281 0.3
282 0.27
283 0.23
284 0.21
285 0.2
286 0.2
287 0.2
288 0.18
289 0.17
290 0.15
291 0.11
292 0.1
293 0.1
294 0.07
295 0.06
296 0.06
297 0.06
298 0.07
299 0.07
300 0.08
301 0.09
302 0.09
303 0.11
304 0.09
305 0.1
306 0.1
307 0.12
308 0.13
309 0.15
310 0.19
311 0.22
312 0.27
313 0.35
314 0.41
315 0.49
316 0.57
317 0.65
318 0.71
319 0.78
320 0.79
321 0.8
322 0.84
323 0.82
324 0.78
325 0.76
326 0.67
327 0.6
328 0.62
329 0.57
330 0.54
331 0.53
332 0.55
333 0.57
334 0.65
335 0.64
336 0.6
337 0.59
338 0.55
339 0.49
340 0.44
341 0.35
342 0.28
343 0.28
344 0.25
345 0.25
346 0.22
347 0.22
348 0.21
349 0.26
350 0.26
351 0.31
352 0.35
353 0.35
354 0.43
355 0.44
356 0.44
357 0.44
358 0.51
359 0.53
360 0.55
361 0.57
362 0.51
363 0.56
364 0.62
365 0.59
366 0.58
367 0.57
368 0.58
369 0.62
370 0.69
371 0.66
372 0.64
373 0.71
374 0.71
375 0.72
376 0.74
377 0.72
378 0.69
379 0.69
380 0.64
381 0.59
382 0.58
383 0.51
384 0.47
385 0.46
386 0.42
387 0.39
388 0.37
389 0.31
390 0.23
391 0.21
392 0.16
393 0.11
394 0.13
395 0.19
396 0.22
397 0.24
398 0.29
399 0.36
400 0.41
401 0.45
402 0.5
403 0.52
404 0.53
405 0.61
406 0.59
407 0.55
408 0.5
409 0.44
410 0.38
411 0.32
412 0.35
413 0.36
414 0.4
415 0.47
416 0.53
417 0.63
418 0.72
419 0.74
420 0.72
421 0.73
422 0.74
423 0.72
424 0.73
425 0.74
426 0.68
427 0.65
428 0.68