Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7Z146

Protein Details
Accession R7Z146   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
164-204GYDQRSPKEGKKKKKVRDETPAPERPRRERRDSNHFPRQNABasic
NLS Segment(s)
PositionSequence
170-194PKEGKKKKKVRDETPAPERPRRERR
Subcellular Location(s) nucl 17, cyto 6, mito 3
Family & Domain DBs
Amino Acid Sequences MSDPSPSCAICYAPPDTCPCESERLAIAVEQAERRRMDEQLKHIREWVIEHSRIHILHAFTRLTSARKAAHTAYLSSLPHYAIYMQYSGRPPLHPQAMAQLQAQIAEAHAELKRGIDADWRASVLRYPEVLDYFYSLVELKLPGDRSAEVVNPPFARAGYADQGYDQRSPKEGKKKKKVRDETPAPERPRRERRDSNHFPRQNAPPVVPTPPIHPGYGPYGHGGGYSGYGYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.31
4 0.31
5 0.31
6 0.29
7 0.31
8 0.3
9 0.31
10 0.28
11 0.25
12 0.24
13 0.22
14 0.21
15 0.17
16 0.19
17 0.2
18 0.21
19 0.24
20 0.24
21 0.26
22 0.27
23 0.29
24 0.35
25 0.36
26 0.44
27 0.5
28 0.53
29 0.51
30 0.52
31 0.5
32 0.42
33 0.38
34 0.37
35 0.33
36 0.33
37 0.32
38 0.32
39 0.34
40 0.33
41 0.33
42 0.28
43 0.22
44 0.22
45 0.25
46 0.23
47 0.19
48 0.22
49 0.22
50 0.2
51 0.2
52 0.2
53 0.2
54 0.21
55 0.25
56 0.22
57 0.26
58 0.25
59 0.25
60 0.24
61 0.24
62 0.23
63 0.21
64 0.2
65 0.15
66 0.14
67 0.13
68 0.11
69 0.08
70 0.09
71 0.09
72 0.09
73 0.11
74 0.13
75 0.15
76 0.16
77 0.16
78 0.18
79 0.22
80 0.25
81 0.22
82 0.21
83 0.24
84 0.24
85 0.25
86 0.22
87 0.18
88 0.15
89 0.15
90 0.15
91 0.09
92 0.07
93 0.06
94 0.06
95 0.06
96 0.06
97 0.07
98 0.06
99 0.06
100 0.07
101 0.06
102 0.07
103 0.09
104 0.09
105 0.11
106 0.11
107 0.12
108 0.11
109 0.11
110 0.12
111 0.1
112 0.11
113 0.09
114 0.1
115 0.1
116 0.11
117 0.12
118 0.1
119 0.1
120 0.09
121 0.09
122 0.08
123 0.07
124 0.07
125 0.07
126 0.07
127 0.06
128 0.08
129 0.1
130 0.1
131 0.11
132 0.11
133 0.12
134 0.13
135 0.14
136 0.13
137 0.14
138 0.16
139 0.15
140 0.15
141 0.14
142 0.12
143 0.12
144 0.11
145 0.13
146 0.13
147 0.14
148 0.13
149 0.14
150 0.16
151 0.18
152 0.21
153 0.2
154 0.17
155 0.2
156 0.25
157 0.31
158 0.4
159 0.47
160 0.54
161 0.64
162 0.73
163 0.79
164 0.86
165 0.88
166 0.86
167 0.89
168 0.88
169 0.86
170 0.86
171 0.85
172 0.8
173 0.77
174 0.74
175 0.73
176 0.74
177 0.72
178 0.72
179 0.73
180 0.75
181 0.8
182 0.84
183 0.84
184 0.84
185 0.81
186 0.75
187 0.71
188 0.71
189 0.69
190 0.61
191 0.54
192 0.48
193 0.46
194 0.46
195 0.44
196 0.37
197 0.32
198 0.36
199 0.36
200 0.32
201 0.29
202 0.29
203 0.3
204 0.32
205 0.29
206 0.24
207 0.23
208 0.22
209 0.21
210 0.19
211 0.13
212 0.12