Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7Z618

Protein Details
Accession R7Z618   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
89-108YLKYLTKKFLKKQQLRDWLRHydrophilic
NLS Segment(s)
PositionSequence
7-25RPQGAGGPKGGPKKGQKIT
Subcellular Location(s) nucl 13, cyto 6, pero 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAQGTKRPQGAGGPKGGPKKGQKITKKYIINASQPANDKIFDVTAFEKFLHDRIKVDGRTGNLGDTINISQAGEGKIEVIAHQEFSGRYLKYLTKKFLKKQQLRDWLRVVSTSKGVYELRFFNVVNDDADEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.49
4 0.48
5 0.47
6 0.52
7 0.55
8 0.6
9 0.65
10 0.69
11 0.75
12 0.78
13 0.75
14 0.69
15 0.7
16 0.67
17 0.62
18 0.58
19 0.53
20 0.48
21 0.47
22 0.45
23 0.37
24 0.31
25 0.26
26 0.21
27 0.19
28 0.14
29 0.13
30 0.12
31 0.11
32 0.12
33 0.12
34 0.12
35 0.12
36 0.15
37 0.17
38 0.16
39 0.16
40 0.19
41 0.25
42 0.25
43 0.26
44 0.25
45 0.22
46 0.25
47 0.24
48 0.2
49 0.14
50 0.14
51 0.12
52 0.11
53 0.1
54 0.07
55 0.07
56 0.06
57 0.05
58 0.07
59 0.07
60 0.06
61 0.06
62 0.05
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.07
69 0.07
70 0.08
71 0.08
72 0.1
73 0.15
74 0.12
75 0.12
76 0.14
77 0.19
78 0.26
79 0.31
80 0.36
81 0.41
82 0.48
83 0.55
84 0.62
85 0.69
86 0.7
87 0.75
88 0.79
89 0.8
90 0.79
91 0.78
92 0.72
93 0.64
94 0.56
95 0.49
96 0.42
97 0.34
98 0.31
99 0.26
100 0.22
101 0.23
102 0.23
103 0.21
104 0.23
105 0.22
106 0.22
107 0.24
108 0.24
109 0.23
110 0.26
111 0.25
112 0.22
113 0.21
114 0.19