Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7YKD2

Protein Details
Accession R7YKD2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 11.5, mito_nucl 9.5, cyto 7, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKANHAVVLDKSTSDKLQKDVQSYRLITVATLVDRLKINGSLARKALADLEEKGQIKKVVGHSKLSIYTRAVGAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.88
9 0.85
10 0.83
11 0.74
12 0.66
13 0.55
14 0.51
15 0.41
16 0.36
17 0.29
18 0.2
19 0.18
20 0.17
21 0.18
22 0.16
23 0.17
24 0.17
25 0.24
26 0.26
27 0.3
28 0.31
29 0.33
30 0.35
31 0.34
32 0.31
33 0.26
34 0.23
35 0.17
36 0.16
37 0.13
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.1
47 0.12
48 0.15
49 0.16
50 0.16
51 0.17
52 0.16
53 0.16
54 0.16
55 0.14
56 0.14
57 0.13
58 0.15
59 0.2
60 0.21
61 0.21
62 0.22
63 0.22
64 0.21
65 0.25
66 0.31
67 0.35
68 0.37
69 0.41
70 0.4
71 0.42
72 0.47
73 0.44
74 0.39
75 0.32
76 0.31
77 0.28