Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YMH5

Protein Details
Accession R7YMH5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
97-120EPVTPAKKKAAPRKRKTKADGEGABasic
122-148EEPVTPAKKKATPRKKKGETAVKSEIKHydrophilic
NLS Segment(s)
PositionSequence
102-139AKKKAAPRKRKTKADGEGAEEEPVTPAKKKATPRKKKG
Subcellular Location(s) cyto 15.5, cyto_nucl 10.5, nucl 4.5, E.R. 3, mito 2
Family & Domain DBs
Amino Acid Sequences MRYDYNFVKDNNVLSDADKDRIVCIVLNATIAGADLPIDWDTAATAFGSKSAKSFKQSFTDSLKKITKAGGGSHEPGTQAATMATTATGDGDGATPEPVTPAKKKAAPRKRKTKADGEGAEEEPVTPAKKKATPRKKKGETAVKSEIKAEGEGEEDVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.29
3 0.26
4 0.26
5 0.24
6 0.22
7 0.2
8 0.2
9 0.2
10 0.13
11 0.11
12 0.12
13 0.11
14 0.11
15 0.1
16 0.09
17 0.08
18 0.08
19 0.06
20 0.04
21 0.04
22 0.03
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.06
30 0.06
31 0.04
32 0.05
33 0.04
34 0.07
35 0.08
36 0.08
37 0.1
38 0.15
39 0.17
40 0.21
41 0.26
42 0.27
43 0.32
44 0.34
45 0.36
46 0.39
47 0.44
48 0.4
49 0.43
50 0.43
51 0.38
52 0.36
53 0.33
54 0.28
55 0.22
56 0.23
57 0.21
58 0.2
59 0.21
60 0.22
61 0.21
62 0.18
63 0.17
64 0.16
65 0.11
66 0.09
67 0.06
68 0.05
69 0.04
70 0.04
71 0.04
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.05
85 0.07
86 0.1
87 0.12
88 0.16
89 0.2
90 0.25
91 0.33
92 0.43
93 0.53
94 0.61
95 0.69
96 0.77
97 0.82
98 0.87
99 0.85
100 0.84
101 0.8
102 0.79
103 0.72
104 0.66
105 0.6
106 0.52
107 0.46
108 0.36
109 0.28
110 0.19
111 0.18
112 0.14
113 0.11
114 0.13
115 0.18
116 0.24
117 0.33
118 0.44
119 0.54
120 0.63
121 0.72
122 0.81
123 0.85
124 0.88
125 0.89
126 0.88
127 0.83
128 0.81
129 0.81
130 0.74
131 0.66
132 0.59
133 0.51
134 0.42
135 0.36
136 0.28
137 0.19
138 0.17