Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YR27

Protein Details
Accession R7YR27   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
97-126MASKIEKASRQQRKQRKNRSKTMRGTVKAKHydrophilic
NLS Segment(s)
PositionSequence
101-134IEKASRQQRKQRKNRSKTMRGTVKAKGASKDKKK
Subcellular Location(s) mito 17, nucl 6, cyto_nucl 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADSQVTLRTRKFIRNPLLGRKQMVVDVLHPGRPNVSKDELRSKLSELYKSGKDQVSVFGFRTQYGGGKSTGFALIYDSNEAMKKFEPHYRLVRVGMASKIEKASRQQRKQRKNRSKTMRGTVKAKGASKDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.63
3 0.68
4 0.72
5 0.78
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.2
14 0.24
15 0.23
16 0.24
17 0.23
18 0.22
19 0.23
20 0.25
21 0.26
22 0.23
23 0.27
24 0.28
25 0.32
26 0.41
27 0.41
28 0.41
29 0.4
30 0.37
31 0.38
32 0.38
33 0.36
34 0.29
35 0.3
36 0.3
37 0.31
38 0.34
39 0.28
40 0.26
41 0.24
42 0.25
43 0.24
44 0.22
45 0.22
46 0.2
47 0.19
48 0.18
49 0.19
50 0.15
51 0.13
52 0.13
53 0.13
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.07
61 0.08
62 0.08
63 0.09
64 0.09
65 0.09
66 0.09
67 0.1
68 0.1
69 0.1
70 0.1
71 0.12
72 0.14
73 0.2
74 0.22
75 0.26
76 0.32
77 0.35
78 0.36
79 0.34
80 0.34
81 0.3
82 0.3
83 0.26
84 0.23
85 0.2
86 0.19
87 0.21
88 0.19
89 0.2
90 0.26
91 0.35
92 0.42
93 0.51
94 0.6
95 0.68
96 0.78
97 0.87
98 0.91
99 0.92
100 0.91
101 0.92
102 0.92
103 0.92
104 0.9
105 0.9
106 0.89
107 0.84
108 0.79
109 0.74
110 0.72
111 0.68
112 0.63
113 0.59
114 0.59