Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YN13

Protein Details
Accession R7YN13    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
7-53TPTPHRFVLKRDPQQPPKPPPGRRNPASQPTSTPKPRPTPKPLSTPSHydrophilic
NLS Segment(s)
PositionSequence
24-30KPPPGRR
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPPPPSTPTPHRFVLKRDPQQPPKPPPGRRNPASQPTSTPKPRPTPKPLSTPSTSSRQFAQTPRFSFAQTRSHDAPPTPQSTASPASRPQRGLRPLTRAESIEDASQEAEDGDHGDGDGDREMLDALDASAMQQTVEIDEPAAQPEEDGEGHHDRDEGAEEMLFASPEHRAKRRRLSSSLSPPPDLRLPVRSPTRPVSAPSPAPYSSRFLLHPSQPASSQITNEQQSASRRPAFRLPQQHQLDSGSREPLPDTFSPHRRGQKFVPGGMADVVRGWVMDVGSSAGQGRAGRMAGRARGDSEFVVNVQVGNVTLADGLTLLRGLSANRNDLLQEKRLVLTGKARGGNVERVQKGDMVGVRAPSWEIEVKGRTWSVGVDWGTFDGGGGEAGRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.64
3 0.68
4 0.72
5 0.76
6 0.79
7 0.85
8 0.88
9 0.86
10 0.86
11 0.86
12 0.86
13 0.86
14 0.87
15 0.87
16 0.81
17 0.82
18 0.8
19 0.81
20 0.77
21 0.69
22 0.66
23 0.63
24 0.69
25 0.68
26 0.65
27 0.63
28 0.68
29 0.75
30 0.77
31 0.79
32 0.8
33 0.78
34 0.81
35 0.79
36 0.76
37 0.7
38 0.67
39 0.61
40 0.6
41 0.55
42 0.46
43 0.44
44 0.42
45 0.43
46 0.44
47 0.49
48 0.48
49 0.49
50 0.52
51 0.49
52 0.46
53 0.45
54 0.44
55 0.43
56 0.38
57 0.42
58 0.42
59 0.45
60 0.46
61 0.42
62 0.43
63 0.41
64 0.42
65 0.36
66 0.33
67 0.3
68 0.32
69 0.36
70 0.31
71 0.29
72 0.31
73 0.36
74 0.4
75 0.42
76 0.42
77 0.46
78 0.5
79 0.55
80 0.54
81 0.55
82 0.55
83 0.55
84 0.53
85 0.45
86 0.4
87 0.35
88 0.31
89 0.25
90 0.21
91 0.17
92 0.15
93 0.13
94 0.11
95 0.08
96 0.06
97 0.05
98 0.06
99 0.06
100 0.05
101 0.05
102 0.06
103 0.06
104 0.06
105 0.07
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.04
113 0.03
114 0.04
115 0.03
116 0.04
117 0.05
118 0.05
119 0.04
120 0.05
121 0.05
122 0.06
123 0.07
124 0.06
125 0.06
126 0.07
127 0.07
128 0.08
129 0.09
130 0.07
131 0.07
132 0.07
133 0.08
134 0.07
135 0.07
136 0.11
137 0.12
138 0.13
139 0.13
140 0.13
141 0.11
142 0.12
143 0.13
144 0.09
145 0.08
146 0.07
147 0.07
148 0.07
149 0.07
150 0.07
151 0.05
152 0.05
153 0.07
154 0.11
155 0.15
156 0.21
157 0.26
158 0.33
159 0.43
160 0.51
161 0.54
162 0.55
163 0.58
164 0.61
165 0.66
166 0.68
167 0.6
168 0.53
169 0.47
170 0.45
171 0.4
172 0.33
173 0.24
174 0.21
175 0.2
176 0.25
177 0.3
178 0.29
179 0.31
180 0.32
181 0.34
182 0.3
183 0.3
184 0.28
185 0.27
186 0.27
187 0.25
188 0.26
189 0.23
190 0.23
191 0.23
192 0.22
193 0.19
194 0.19
195 0.18
196 0.18
197 0.21
198 0.22
199 0.25
200 0.23
201 0.23
202 0.22
203 0.24
204 0.24
205 0.21
206 0.19
207 0.18
208 0.21
209 0.22
210 0.22
211 0.2
212 0.19
213 0.22
214 0.25
215 0.27
216 0.27
217 0.27
218 0.29
219 0.36
220 0.38
221 0.42
222 0.49
223 0.48
224 0.53
225 0.55
226 0.53
227 0.47
228 0.45
229 0.4
230 0.33
231 0.31
232 0.23
233 0.2
234 0.2
235 0.19
236 0.17
237 0.19
238 0.16
239 0.21
240 0.25
241 0.31
242 0.36
243 0.42
244 0.5
245 0.48
246 0.52
247 0.49
248 0.52
249 0.5
250 0.46
251 0.44
252 0.35
253 0.34
254 0.3
255 0.26
256 0.16
257 0.12
258 0.11
259 0.07
260 0.06
261 0.06
262 0.05
263 0.05
264 0.05
265 0.05
266 0.06
267 0.06
268 0.06
269 0.07
270 0.06
271 0.08
272 0.08
273 0.08
274 0.09
275 0.09
276 0.1
277 0.13
278 0.16
279 0.19
280 0.21
281 0.21
282 0.22
283 0.22
284 0.23
285 0.2
286 0.19
287 0.16
288 0.13
289 0.14
290 0.11
291 0.1
292 0.09
293 0.08
294 0.07
295 0.06
296 0.06
297 0.05
298 0.05
299 0.05
300 0.05
301 0.04
302 0.04
303 0.04
304 0.04
305 0.04
306 0.04
307 0.05
308 0.06
309 0.14
310 0.17
311 0.19
312 0.2
313 0.2
314 0.21
315 0.26
316 0.29
317 0.26
318 0.26
319 0.25
320 0.25
321 0.28
322 0.29
323 0.26
324 0.29
325 0.31
326 0.35
327 0.36
328 0.35
329 0.36
330 0.38
331 0.45
332 0.43
333 0.46
334 0.41
335 0.4
336 0.42
337 0.39
338 0.35
339 0.32
340 0.28
341 0.23
342 0.24
343 0.23
344 0.22
345 0.22
346 0.22
347 0.17
348 0.18
349 0.17
350 0.17
351 0.22
352 0.24
353 0.24
354 0.28
355 0.28
356 0.25
357 0.22
358 0.21
359 0.17
360 0.22
361 0.22
362 0.19
363 0.19
364 0.2
365 0.2
366 0.18
367 0.16
368 0.09
369 0.08
370 0.08