Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7Z3W1

Protein Details
Accession R7Z3W1    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-32VPTSADPRSKRPTKKRALTPVSAQHydrophilic
120-144RDEAKTNKNKARREKNKARLAKKGKBasic
NLS Segment(s)
PositionSequence
116-145ETRRRDEAKTNKNKARREKNKARLAKKGKG
Subcellular Location(s) nucl 16, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSEPIPESVPTSADPRSKRPTKKRALTPVSAQANQVEALFAHPDREIALPSGPKPKNLAPPPEIVANVQGSSAGAGSGEFHVYKASRRREYERLRLMDEETKKENADAEFEVKREETRRRDEAKTNKNKARREKNKARLAKKGKGGEGMEVDGDGDGVVNEQERGKVKKLGPMSVGARSGADGEADNGVLNGGGEVKSADEVGIIIHDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.45
4 0.53
5 0.62
6 0.7
7 0.75
8 0.79
9 0.86
10 0.88
11 0.89
12 0.88
13 0.83
14 0.78
15 0.77
16 0.72
17 0.63
18 0.54
19 0.43
20 0.37
21 0.32
22 0.25
23 0.16
24 0.09
25 0.1
26 0.11
27 0.11
28 0.1
29 0.1
30 0.1
31 0.11
32 0.12
33 0.12
34 0.1
35 0.14
36 0.14
37 0.17
38 0.27
39 0.26
40 0.27
41 0.3
42 0.34
43 0.41
44 0.44
45 0.49
46 0.42
47 0.45
48 0.45
49 0.43
50 0.38
51 0.28
52 0.25
53 0.19
54 0.16
55 0.12
56 0.1
57 0.08
58 0.07
59 0.07
60 0.04
61 0.03
62 0.03
63 0.04
64 0.05
65 0.06
66 0.05
67 0.06
68 0.07
69 0.08
70 0.13
71 0.2
72 0.27
73 0.32
74 0.36
75 0.42
76 0.51
77 0.58
78 0.63
79 0.63
80 0.58
81 0.54
82 0.51
83 0.47
84 0.44
85 0.39
86 0.33
87 0.27
88 0.25
89 0.23
90 0.22
91 0.22
92 0.15
93 0.15
94 0.12
95 0.13
96 0.13
97 0.13
98 0.14
99 0.12
100 0.13
101 0.15
102 0.22
103 0.24
104 0.3
105 0.37
106 0.42
107 0.46
108 0.53
109 0.59
110 0.63
111 0.68
112 0.7
113 0.69
114 0.72
115 0.75
116 0.77
117 0.78
118 0.78
119 0.78
120 0.8
121 0.84
122 0.86
123 0.88
124 0.83
125 0.82
126 0.8
127 0.76
128 0.73
129 0.68
130 0.6
131 0.57
132 0.52
133 0.45
134 0.38
135 0.31
136 0.23
137 0.18
138 0.16
139 0.1
140 0.09
141 0.05
142 0.04
143 0.03
144 0.03
145 0.03
146 0.04
147 0.05
148 0.05
149 0.09
150 0.13
151 0.17
152 0.2
153 0.28
154 0.29
155 0.35
156 0.38
157 0.4
158 0.37
159 0.39
160 0.39
161 0.36
162 0.35
163 0.29
164 0.25
165 0.21
166 0.21
167 0.15
168 0.12
169 0.08
170 0.09
171 0.09
172 0.09
173 0.08
174 0.07
175 0.07
176 0.06
177 0.05
178 0.04
179 0.05
180 0.05
181 0.05
182 0.06
183 0.06
184 0.07
185 0.07
186 0.07
187 0.06
188 0.06
189 0.06
190 0.07