Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7YQ18

Protein Details
Accession R7YQ18    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
162-184IVDLQEKKKKTPRGAKAWVEHCLHydrophilic
NLS Segment(s)
PositionSequence
169-172KKKT
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MIARGSKVEKFEDTRDSTLDIIIKLPDGNQSFCRSRKSSLTRTRISAKLQEIQRQLEEASAKYDSELQGVLALQKEELERLRDDSRRAQDELRYQNRNAHRDAEIRIKDLKQLLVRQMQEAELSVKAQRIENRREFEQIVAKLMEDEGRIRTEKRRFMEQTIVDLQEKKKKTPRGAKAWVEHCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.4
3 0.38
4 0.33
5 0.31
6 0.28
7 0.21
8 0.17
9 0.15
10 0.14
11 0.12
12 0.12
13 0.17
14 0.17
15 0.2
16 0.21
17 0.27
18 0.32
19 0.35
20 0.42
21 0.38
22 0.4
23 0.47
24 0.52
25 0.56
26 0.62
27 0.67
28 0.64
29 0.66
30 0.68
31 0.62
32 0.58
33 0.54
34 0.47
35 0.46
36 0.46
37 0.48
38 0.45
39 0.44
40 0.4
41 0.34
42 0.3
43 0.26
44 0.23
45 0.16
46 0.15
47 0.13
48 0.13
49 0.12
50 0.14
51 0.12
52 0.11
53 0.11
54 0.08
55 0.08
56 0.08
57 0.09
58 0.07
59 0.07
60 0.06
61 0.07
62 0.07
63 0.08
64 0.09
65 0.1
66 0.1
67 0.14
68 0.18
69 0.2
70 0.22
71 0.28
72 0.31
73 0.32
74 0.33
75 0.31
76 0.31
77 0.36
78 0.43
79 0.42
80 0.4
81 0.38
82 0.43
83 0.47
84 0.46
85 0.4
86 0.34
87 0.3
88 0.3
89 0.32
90 0.35
91 0.29
92 0.29
93 0.3
94 0.27
95 0.27
96 0.26
97 0.27
98 0.21
99 0.23
100 0.26
101 0.29
102 0.29
103 0.28
104 0.27
105 0.24
106 0.2
107 0.18
108 0.15
109 0.1
110 0.1
111 0.1
112 0.11
113 0.12
114 0.15
115 0.2
116 0.25
117 0.33
118 0.39
119 0.43
120 0.44
121 0.46
122 0.44
123 0.42
124 0.42
125 0.34
126 0.3
127 0.26
128 0.24
129 0.2
130 0.2
131 0.18
132 0.11
133 0.12
134 0.11
135 0.14
136 0.15
137 0.17
138 0.26
139 0.32
140 0.39
141 0.42
142 0.5
143 0.51
144 0.55
145 0.62
146 0.56
147 0.54
148 0.51
149 0.5
150 0.42
151 0.42
152 0.42
153 0.41
154 0.42
155 0.43
156 0.47
157 0.53
158 0.62
159 0.69
160 0.74
161 0.76
162 0.83
163 0.84
164 0.84