Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YV06

Protein Details
Accession R7YV06    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-66AFCTAWKSFNKSRRKSQKSIFPDPSRKSHydrophilic
348-374DVPVAAVKPKSRRKTARKTKGAQSTGAHydrophilic
NLS Segment(s)
PositionSequence
355-367KPKSRRKTARKTK
Subcellular Location(s) cyto_mito 12, mito 11.5, cyto 11.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024604  GSG2_C  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF12330  Haspin_kinase  
Amino Acid Sequences MSTISQVASEVQLLQRMTSIPGFTNFRDIRVLQGRPPPAFCTAWKSFNKSRRKSQKSIFPDPSRKSSYDDEQLWAVIEMQDAGTDLERLIEEGTEAIGGIWGVWDVFWGVVLALGKGEEGCRFEHRDLHLGNVCVRPTHAGSDSIISAPEIRRLDHNLGFTGLETTIIDYTLSRADMEAASPLSNGAASPQVAYLNLEADQALFEGDGELEYQYDIYRFMRAAMYLDEPLADLDARWGEAMQSGRTWEGYHPQTNLVWLHFILYQMLERVVWPSSGEAGVLSRLGEGVDEVAAARKAGRIEKVLVRLQDLLDPGRLPASGLRSAKDLVGMALREGWLDEGDVIGSLEDVPVAAVKPKSRRKTARKTKGAQSTGAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.18
5 0.18
6 0.19
7 0.16
8 0.22
9 0.26
10 0.25
11 0.34
12 0.32
13 0.31
14 0.34
15 0.32
16 0.36
17 0.39
18 0.41
19 0.37
20 0.45
21 0.49
22 0.47
23 0.49
24 0.43
25 0.4
26 0.4
27 0.36
28 0.37
29 0.36
30 0.42
31 0.44
32 0.49
33 0.53
34 0.59
35 0.68
36 0.67
37 0.73
38 0.76
39 0.81
40 0.81
41 0.82
42 0.84
43 0.82
44 0.85
45 0.84
46 0.82
47 0.83
48 0.79
49 0.78
50 0.73
51 0.66
52 0.6
53 0.55
54 0.52
55 0.51
56 0.48
57 0.42
58 0.37
59 0.35
60 0.31
61 0.25
62 0.19
63 0.11
64 0.09
65 0.07
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.07
76 0.06
77 0.06
78 0.05
79 0.05
80 0.06
81 0.04
82 0.05
83 0.04
84 0.04
85 0.04
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.06
105 0.06
106 0.07
107 0.09
108 0.13
109 0.17
110 0.18
111 0.23
112 0.25
113 0.29
114 0.28
115 0.31
116 0.31
117 0.28
118 0.31
119 0.28
120 0.26
121 0.2
122 0.2
123 0.17
124 0.15
125 0.17
126 0.15
127 0.13
128 0.14
129 0.15
130 0.15
131 0.13
132 0.12
133 0.09
134 0.1
135 0.09
136 0.14
137 0.13
138 0.13
139 0.15
140 0.19
141 0.24
142 0.25
143 0.25
144 0.2
145 0.2
146 0.2
147 0.18
148 0.15
149 0.1
150 0.08
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.04
157 0.05
158 0.06
159 0.06
160 0.05
161 0.05
162 0.06
163 0.06
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.05
171 0.05
172 0.04
173 0.04
174 0.04
175 0.05
176 0.05
177 0.05
178 0.06
179 0.06
180 0.07
181 0.06
182 0.06
183 0.06
184 0.06
185 0.05
186 0.05
187 0.05
188 0.04
189 0.04
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.04
200 0.04
201 0.04
202 0.05
203 0.05
204 0.06
205 0.06
206 0.08
207 0.08
208 0.08
209 0.09
210 0.1
211 0.11
212 0.11
213 0.1
214 0.09
215 0.09
216 0.08
217 0.08
218 0.06
219 0.04
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.05
226 0.08
227 0.09
228 0.09
229 0.09
230 0.1
231 0.1
232 0.11
233 0.12
234 0.1
235 0.16
236 0.2
237 0.22
238 0.22
239 0.24
240 0.23
241 0.25
242 0.25
243 0.19
244 0.15
245 0.12
246 0.13
247 0.12
248 0.12
249 0.1
250 0.09
251 0.09
252 0.09
253 0.09
254 0.07
255 0.07
256 0.08
257 0.08
258 0.08
259 0.08
260 0.08
261 0.09
262 0.09
263 0.09
264 0.07
265 0.07
266 0.07
267 0.07
268 0.07
269 0.05
270 0.05
271 0.05
272 0.05
273 0.04
274 0.05
275 0.04
276 0.04
277 0.04
278 0.06
279 0.06
280 0.07
281 0.07
282 0.08
283 0.11
284 0.14
285 0.17
286 0.19
287 0.23
288 0.28
289 0.34
290 0.36
291 0.35
292 0.34
293 0.33
294 0.3
295 0.29
296 0.25
297 0.21
298 0.18
299 0.18
300 0.16
301 0.15
302 0.14
303 0.12
304 0.13
305 0.16
306 0.22
307 0.23
308 0.24
309 0.25
310 0.26
311 0.26
312 0.24
313 0.2
314 0.14
315 0.16
316 0.15
317 0.13
318 0.14
319 0.14
320 0.12
321 0.12
322 0.12
323 0.08
324 0.08
325 0.08
326 0.06
327 0.07
328 0.07
329 0.06
330 0.05
331 0.05
332 0.05
333 0.05
334 0.04
335 0.04
336 0.04
337 0.05
338 0.06
339 0.1
340 0.13
341 0.2
342 0.3
343 0.4
344 0.49
345 0.59
346 0.69
347 0.75
348 0.84
349 0.89
350 0.91
351 0.91
352 0.91
353 0.9
354 0.9
355 0.83