Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YUM3

Protein Details
Accession R7YUM3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-101TINRGRQWKDIKKRYIEHDDDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, plas 5, golg 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MAGVGQRRAHKITPKLTTRIADIIRDLQARLPPRSATKLDPANAFLSTLIRKNTVFLGTIFLGAFAIQMGFDTAADRIWDTINRGRQWKDIKKRYIEHDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.6
3 0.61
4 0.57
5 0.51
6 0.5
7 0.43
8 0.35
9 0.31
10 0.29
11 0.28
12 0.27
13 0.24
14 0.2
15 0.23
16 0.26
17 0.26
18 0.24
19 0.23
20 0.26
21 0.31
22 0.31
23 0.29
24 0.31
25 0.34
26 0.34
27 0.33
28 0.32
29 0.28
30 0.25
31 0.22
32 0.16
33 0.13
34 0.12
35 0.13
36 0.11
37 0.11
38 0.11
39 0.12
40 0.13
41 0.12
42 0.12
43 0.1
44 0.12
45 0.11
46 0.12
47 0.11
48 0.09
49 0.08
50 0.07
51 0.07
52 0.04
53 0.03
54 0.02
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.05
61 0.05
62 0.06
63 0.06
64 0.06
65 0.08
66 0.09
67 0.14
68 0.2
69 0.27
70 0.31
71 0.36
72 0.38
73 0.44
74 0.53
75 0.59
76 0.64
77 0.66
78 0.71
79 0.75
80 0.79
81 0.8
82 0.8