Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YYF9

Protein Details
Accession R7YYF9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
64-86RACMDAPRPKNQKKNNINYHLSRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MPPKVGSSTAVTASRLPPLPNLRVRRPNRADVNPCLGIMTSVLGCWASSGYDVAGCGVLEQQLRACMDAPRPKNQKKNNINYHLSRMYPRIAGPQKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.23
4 0.25
5 0.29
6 0.35
7 0.41
8 0.47
9 0.51
10 0.59
11 0.63
12 0.68
13 0.67
14 0.69
15 0.69
16 0.71
17 0.68
18 0.62
19 0.64
20 0.54
21 0.48
22 0.39
23 0.31
24 0.22
25 0.16
26 0.12
27 0.05
28 0.04
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.03
35 0.03
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.05
46 0.05
47 0.06
48 0.06
49 0.08
50 0.09
51 0.09
52 0.1
53 0.11
54 0.18
55 0.26
56 0.29
57 0.37
58 0.46
59 0.54
60 0.63
61 0.69
62 0.73
63 0.76
64 0.83
65 0.84
66 0.83
67 0.82
68 0.77
69 0.76
70 0.68
71 0.6
72 0.53
73 0.45
74 0.4
75 0.35
76 0.32
77 0.34
78 0.4