Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YGX9

Protein Details
Accession R7YGX9   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
22-45KLFLRAPRLSRKVRHPQTGRIISFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR000073  AB_hydrolase_1  
Pfam View protein in Pfam  
PF12697  Abhydrolase_6  
Amino Acid Sequences MLNEPTLEERPSSADSIDEDVKLFLRAPRLSRKVRHPQTGRIISFSEVGDPQGFAVICCVGMGLTRYVMAFYDELAASLKLRLITPDRPGVGESESDPSGTPLSWPDDIQIICNSLGITKFSLLAHSAGAIYALATALRMPQHIRGRVHLLAPWIPPSQMSSIGLRPDAPPAGQLPKSQRFLRALPTSFLKVANSAFMSGTSAGISRSNSSTAVLAGQPANKRRRSLMLGRGLFESASAPSFSSATSTTTTTQKPAAEASNRDSMLQMDREIPTGSSLPNQPSSGTTTTTILSDSELAARRRLYDARLTLSIWALATHSANPAHDLVVCLERHRPIGFRYVDITRAVVVHHGSRDTRVPLENVKWLGRTMPRCEVRVLEGEGHGLMASAAVMGRVLEEVGREWGEWMEVVEGRGRRAGSEAVRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.23
4 0.24
5 0.21
6 0.18
7 0.18
8 0.18
9 0.18
10 0.18
11 0.16
12 0.21
13 0.25
14 0.3
15 0.4
16 0.48
17 0.56
18 0.62
19 0.69
20 0.73
21 0.78
22 0.83
23 0.78
24 0.79
25 0.81
26 0.84
27 0.75
28 0.66
29 0.59
30 0.5
31 0.46
32 0.36
33 0.29
34 0.19
35 0.2
36 0.17
37 0.15
38 0.14
39 0.15
40 0.14
41 0.11
42 0.12
43 0.1
44 0.09
45 0.09
46 0.09
47 0.05
48 0.06
49 0.08
50 0.08
51 0.08
52 0.08
53 0.09
54 0.09
55 0.09
56 0.1
57 0.09
58 0.08
59 0.11
60 0.1
61 0.11
62 0.12
63 0.12
64 0.1
65 0.11
66 0.12
67 0.1
68 0.1
69 0.14
70 0.18
71 0.22
72 0.26
73 0.31
74 0.3
75 0.3
76 0.3
77 0.28
78 0.25
79 0.21
80 0.18
81 0.16
82 0.15
83 0.15
84 0.14
85 0.14
86 0.13
87 0.12
88 0.11
89 0.1
90 0.14
91 0.14
92 0.14
93 0.14
94 0.18
95 0.18
96 0.19
97 0.17
98 0.16
99 0.14
100 0.15
101 0.14
102 0.11
103 0.12
104 0.11
105 0.11
106 0.09
107 0.11
108 0.1
109 0.12
110 0.11
111 0.11
112 0.1
113 0.09
114 0.09
115 0.07
116 0.07
117 0.06
118 0.04
119 0.04
120 0.04
121 0.03
122 0.03
123 0.03
124 0.05
125 0.06
126 0.07
127 0.08
128 0.16
129 0.23
130 0.29
131 0.3
132 0.32
133 0.37
134 0.38
135 0.37
136 0.31
137 0.27
138 0.24
139 0.23
140 0.24
141 0.19
142 0.17
143 0.16
144 0.16
145 0.15
146 0.14
147 0.14
148 0.13
149 0.15
150 0.16
151 0.16
152 0.15
153 0.14
154 0.15
155 0.14
156 0.12
157 0.1
158 0.11
159 0.16
160 0.16
161 0.19
162 0.24
163 0.3
164 0.35
165 0.35
166 0.37
167 0.36
168 0.36
169 0.41
170 0.39
171 0.34
172 0.32
173 0.32
174 0.3
175 0.27
176 0.26
177 0.19
178 0.14
179 0.13
180 0.13
181 0.11
182 0.09
183 0.08
184 0.08
185 0.09
186 0.08
187 0.07
188 0.06
189 0.06
190 0.06
191 0.07
192 0.07
193 0.08
194 0.08
195 0.09
196 0.09
197 0.09
198 0.09
199 0.08
200 0.08
201 0.07
202 0.07
203 0.08
204 0.11
205 0.13
206 0.2
207 0.27
208 0.28
209 0.29
210 0.3
211 0.34
212 0.36
213 0.4
214 0.42
215 0.44
216 0.44
217 0.44
218 0.42
219 0.38
220 0.32
221 0.25
222 0.17
223 0.08
224 0.07
225 0.06
226 0.06
227 0.06
228 0.06
229 0.06
230 0.07
231 0.07
232 0.08
233 0.09
234 0.11
235 0.12
236 0.16
237 0.17
238 0.17
239 0.19
240 0.18
241 0.17
242 0.18
243 0.21
244 0.21
245 0.22
246 0.25
247 0.28
248 0.28
249 0.27
250 0.25
251 0.22
252 0.21
253 0.2
254 0.17
255 0.14
256 0.14
257 0.15
258 0.15
259 0.14
260 0.13
261 0.12
262 0.12
263 0.12
264 0.14
265 0.16
266 0.18
267 0.18
268 0.17
269 0.17
270 0.22
271 0.2
272 0.19
273 0.18
274 0.17
275 0.17
276 0.17
277 0.16
278 0.11
279 0.1
280 0.09
281 0.08
282 0.11
283 0.16
284 0.17
285 0.19
286 0.19
287 0.2
288 0.23
289 0.24
290 0.23
291 0.25
292 0.27
293 0.29
294 0.3
295 0.29
296 0.26
297 0.25
298 0.23
299 0.15
300 0.12
301 0.09
302 0.09
303 0.09
304 0.09
305 0.11
306 0.11
307 0.12
308 0.13
309 0.13
310 0.13
311 0.12
312 0.13
313 0.12
314 0.16
315 0.16
316 0.16
317 0.19
318 0.2
319 0.22
320 0.22
321 0.23
322 0.2
323 0.28
324 0.29
325 0.27
326 0.29
327 0.29
328 0.3
329 0.28
330 0.27
331 0.19
332 0.17
333 0.16
334 0.14
335 0.14
336 0.15
337 0.16
338 0.18
339 0.18
340 0.21
341 0.25
342 0.25
343 0.27
344 0.26
345 0.27
346 0.3
347 0.33
348 0.37
349 0.36
350 0.35
351 0.33
352 0.31
353 0.33
354 0.35
355 0.37
356 0.37
357 0.44
358 0.46
359 0.47
360 0.48
361 0.45
362 0.41
363 0.41
364 0.38
365 0.31
366 0.27
367 0.26
368 0.23
369 0.21
370 0.17
371 0.11
372 0.08
373 0.05
374 0.05
375 0.04
376 0.04
377 0.04
378 0.04
379 0.04
380 0.04
381 0.05
382 0.05
383 0.05
384 0.06
385 0.08
386 0.11
387 0.12
388 0.12
389 0.13
390 0.13
391 0.13
392 0.12
393 0.12
394 0.11
395 0.12
396 0.13
397 0.17
398 0.18
399 0.19
400 0.23
401 0.22
402 0.2
403 0.22
404 0.28