Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7Z4Y0

Protein Details
Accession R7Z4Y0    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
118-144DVRASTQHRRREKMKRRSASPKAPPGGBasic
NLS Segment(s)
PositionSequence
126-141RRREKMKRRSASPKAP
Subcellular Location(s) nucl 11, cyto 10, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR033473  Atos-like_C  
IPR025261  Atos-like_cons_dom  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF13889  Chromosome_seg  
PF13915  DUF4210  
Amino Acid Sequences MVGSYEESILRGRMSTTPSGPLDFVAQIGVLGKGDCKPNLRCPPHVTVPFPAVFYSYGSGNGRISDDQPSPYVGMIDLEHMLRPSEDNGESRKRRRYHAPPSDVEDNAPNNVGDGDSDVRASTQHRRREKMKRRSASPKAPPGGSYRIPQQGQLQIVIKNPNKTAVKLFLVPYDLSDMGPGQKTFIRQRSYSAGPIIDMPMASRKNLGTDRPEAALSHSDDPNDRPVLRYLIHLNVCCPSKGRFFLYNSVRVVFANRVPDGKEKLRNEIQLPDPRYSLYKPSKTSLSASNAMAHAAAGLVGEKALLRGGVSFSSVQDRLDAVDGISCGGRVSAGASTWTPYSPTDRYSSQPVAPIPFTLARLAPLESRPGSRDAMDLGSPFTGLASSPDYQSPEPPLSGAGSSLGSLLTSRVGSSSGACTGSYGKLSPGDTGYGGNAFGALSSGAVPAAGLLARRLRELDVETGDLPTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.26
4 0.31
5 0.33
6 0.34
7 0.32
8 0.29
9 0.27
10 0.22
11 0.2
12 0.14
13 0.11
14 0.1
15 0.1
16 0.1
17 0.07
18 0.07
19 0.08
20 0.12
21 0.16
22 0.19
23 0.25
24 0.29
25 0.4
26 0.5
27 0.55
28 0.58
29 0.61
30 0.66
31 0.69
32 0.7
33 0.63
34 0.56
35 0.55
36 0.5
37 0.44
38 0.36
39 0.28
40 0.22
41 0.2
42 0.18
43 0.13
44 0.16
45 0.17
46 0.19
47 0.18
48 0.18
49 0.19
50 0.19
51 0.2
52 0.21
53 0.22
54 0.22
55 0.22
56 0.23
57 0.21
58 0.19
59 0.18
60 0.13
61 0.12
62 0.1
63 0.11
64 0.1
65 0.1
66 0.11
67 0.1
68 0.11
69 0.1
70 0.11
71 0.11
72 0.14
73 0.16
74 0.18
75 0.24
76 0.34
77 0.41
78 0.47
79 0.55
80 0.54
81 0.59
82 0.66
83 0.7
84 0.72
85 0.75
86 0.76
87 0.7
88 0.74
89 0.73
90 0.63
91 0.53
92 0.46
93 0.37
94 0.3
95 0.27
96 0.19
97 0.14
98 0.14
99 0.12
100 0.08
101 0.09
102 0.1
103 0.09
104 0.09
105 0.09
106 0.09
107 0.1
108 0.13
109 0.21
110 0.27
111 0.36
112 0.43
113 0.49
114 0.58
115 0.69
116 0.77
117 0.78
118 0.81
119 0.8
120 0.81
121 0.86
122 0.86
123 0.85
124 0.84
125 0.82
126 0.75
127 0.68
128 0.61
129 0.55
130 0.52
131 0.44
132 0.37
133 0.33
134 0.36
135 0.36
136 0.36
137 0.35
138 0.33
139 0.31
140 0.32
141 0.29
142 0.23
143 0.26
144 0.33
145 0.31
146 0.3
147 0.29
148 0.34
149 0.33
150 0.32
151 0.32
152 0.29
153 0.29
154 0.28
155 0.28
156 0.22
157 0.23
158 0.22
159 0.19
160 0.17
161 0.15
162 0.12
163 0.12
164 0.11
165 0.1
166 0.12
167 0.11
168 0.1
169 0.11
170 0.15
171 0.21
172 0.28
173 0.3
174 0.28
175 0.32
176 0.36
177 0.37
178 0.36
179 0.31
180 0.24
181 0.2
182 0.2
183 0.18
184 0.13
185 0.1
186 0.08
187 0.12
188 0.12
189 0.12
190 0.12
191 0.12
192 0.16
193 0.18
194 0.2
195 0.19
196 0.22
197 0.24
198 0.23
199 0.24
200 0.2
201 0.19
202 0.2
203 0.18
204 0.17
205 0.16
206 0.16
207 0.16
208 0.17
209 0.19
210 0.18
211 0.15
212 0.14
213 0.15
214 0.17
215 0.16
216 0.17
217 0.16
218 0.19
219 0.21
220 0.2
221 0.19
222 0.2
223 0.2
224 0.18
225 0.17
226 0.15
227 0.16
228 0.18
229 0.22
230 0.23
231 0.25
232 0.33
233 0.36
234 0.38
235 0.35
236 0.34
237 0.3
238 0.25
239 0.25
240 0.18
241 0.17
242 0.15
243 0.15
244 0.15
245 0.16
246 0.2
247 0.23
248 0.26
249 0.32
250 0.3
251 0.36
252 0.39
253 0.4
254 0.38
255 0.38
256 0.39
257 0.39
258 0.4
259 0.35
260 0.32
261 0.29
262 0.3
263 0.27
264 0.29
265 0.3
266 0.33
267 0.34
268 0.37
269 0.39
270 0.38
271 0.39
272 0.36
273 0.34
274 0.31
275 0.29
276 0.29
277 0.26
278 0.24
279 0.21
280 0.15
281 0.09
282 0.06
283 0.05
284 0.03
285 0.03
286 0.03
287 0.03
288 0.03
289 0.03
290 0.03
291 0.03
292 0.03
293 0.03
294 0.04
295 0.05
296 0.05
297 0.07
298 0.07
299 0.08
300 0.12
301 0.13
302 0.12
303 0.12
304 0.12
305 0.11
306 0.12
307 0.12
308 0.08
309 0.09
310 0.08
311 0.08
312 0.08
313 0.07
314 0.06
315 0.05
316 0.05
317 0.04
318 0.05
319 0.05
320 0.06
321 0.07
322 0.07
323 0.09
324 0.1
325 0.1
326 0.1
327 0.1
328 0.16
329 0.16
330 0.18
331 0.21
332 0.23
333 0.25
334 0.31
335 0.34
336 0.3
337 0.32
338 0.32
339 0.31
340 0.3
341 0.27
342 0.24
343 0.22
344 0.21
345 0.19
346 0.17
347 0.15
348 0.16
349 0.17
350 0.16
351 0.15
352 0.2
353 0.19
354 0.21
355 0.22
356 0.24
357 0.24
358 0.22
359 0.22
360 0.18
361 0.19
362 0.18
363 0.16
364 0.14
365 0.13
366 0.12
367 0.11
368 0.09
369 0.07
370 0.06
371 0.07
372 0.1
373 0.11
374 0.13
375 0.15
376 0.19
377 0.19
378 0.22
379 0.25
380 0.23
381 0.22
382 0.21
383 0.2
384 0.18
385 0.18
386 0.16
387 0.12
388 0.1
389 0.09
390 0.09
391 0.08
392 0.07
393 0.07
394 0.07
395 0.07
396 0.07
397 0.07
398 0.07
399 0.08
400 0.09
401 0.11
402 0.13
403 0.14
404 0.14
405 0.14
406 0.15
407 0.16
408 0.18
409 0.18
410 0.16
411 0.15
412 0.18
413 0.19
414 0.2
415 0.19
416 0.19
417 0.18
418 0.18
419 0.18
420 0.15
421 0.14
422 0.11
423 0.1
424 0.08
425 0.07
426 0.07
427 0.05
428 0.05
429 0.05
430 0.06
431 0.05
432 0.05
433 0.05
434 0.04
435 0.06
436 0.06
437 0.06
438 0.09
439 0.14
440 0.15
441 0.17
442 0.18
443 0.19
444 0.22
445 0.25
446 0.28
447 0.26
448 0.28
449 0.27