Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YI03

Protein Details
Accession R7YI03    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-31EILKGRRQSARHPRPRRAATGBasic
NLS Segment(s)
PositionSequence
14-55KGRRQSARHPRPRRAATGPKATAPAAAPVGGVKKIVRSTKPA
Subcellular Location(s) nucl 18, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MAGKLDQSLDEILKGRRQSARHPRPRRAATGPKATAPAAAPVGGVKKIVRSTKPAGKAAVPTGPSGAGESKIIVSNLPTDVNETQIKVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.29
4 0.31
5 0.4
6 0.48
7 0.57
8 0.63
9 0.71
10 0.76
11 0.8
12 0.83
13 0.79
14 0.76
15 0.75
16 0.71
17 0.72
18 0.64
19 0.55
20 0.52
21 0.45
22 0.38
23 0.28
24 0.22
25 0.13
26 0.11
27 0.1
28 0.08
29 0.09
30 0.08
31 0.08
32 0.06
33 0.08
34 0.12
35 0.16
36 0.17
37 0.21
38 0.27
39 0.33
40 0.39
41 0.39
42 0.37
43 0.35
44 0.35
45 0.32
46 0.3
47 0.24
48 0.19
49 0.18
50 0.16
51 0.15
52 0.14
53 0.13
54 0.1
55 0.09
56 0.1
57 0.1
58 0.12
59 0.12
60 0.1
61 0.1
62 0.12
63 0.13
64 0.14
65 0.12
66 0.16
67 0.16
68 0.2
69 0.21