Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7Z4T4

Protein Details
Accession R7Z4T4    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-43ASSARIKKNKKTNNIKFKVRCHRYHydrophilic
NLS Segment(s)
PositionSequence
25-29IKKNK
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPSEVSDIKQFIEICRRKDASSARIKKNKKTNNIKFKVRCHRYLYTLVLKDSDKAEKLKQSLPPGLTINEVGTKTKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.41
3 0.42
4 0.39
5 0.45
6 0.48
7 0.46
8 0.52
9 0.58
10 0.6
11 0.67
12 0.7
13 0.72
14 0.76
15 0.75
16 0.75
17 0.77
18 0.78
19 0.8
20 0.83
21 0.84
22 0.8
23 0.81
24 0.81
25 0.75
26 0.7
27 0.65
28 0.61
29 0.55
30 0.54
31 0.49
32 0.46
33 0.42
34 0.37
35 0.33
36 0.3
37 0.27
38 0.25
39 0.23
40 0.18
41 0.19
42 0.23
43 0.26
44 0.29
45 0.33
46 0.36
47 0.39
48 0.43
49 0.41
50 0.41
51 0.38
52 0.36
53 0.32
54 0.28
55 0.23
56 0.22
57 0.22
58 0.2