Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7Z7W4

Protein Details
Accession R7Z7W4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
258-284PGGKSESKPSKKQKRKEQRVKLLEEQHBasic
NLS Segment(s)
PositionSequence
245-279RKKEYLARTKTANPGGKSESKPSKKQKRKEQRVKL
Subcellular Location(s) cyto 10.5, nucl 9, cyto_mito 8.5, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR028389  POT1  
IPR032042  POT1PC  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005634  C:nucleus  
GO:0043047  F:single-stranded telomeric DNA binding  
GO:0000723  P:telomere maintenance  
Pfam View protein in Pfam  
PF16686  POT1PC  
Amino Acid Sequences MAYANGNKNIPGMLMSGSRPATTEEQFYSIELRHAFPHLPTNAPISAAATPAAMRSIPNPQTPAGAPPSTITPSKVTPGSAIGASRLDRQALLKDIAADKYYDPIGEVVKIQSASFDRVDIYLTDYTTNRLFYEYLSPEDEAKEAGLGYDGDPMNYLNGKKKAPWPGPCGKMTLLVTLWLPHADWVRDNVHPGDYVCMKNVIVKYNEGSFSRLEGKLHQDRKYPFRVDVWKAKPDEPRVKDLVLRKKEYLARTKTANPGGKSESKPSKKQKRKEQRVKLLEEQHKKQKEPAESSIFFASNTHIRCQDLNRPLVGISKIWENPHLEYESPNGILQLPFINMKYRARVRVVDFWPDKLENFSQSLDSRAYNNCPDEPDSQDMMSDESPQPRGWEWFFYVWVMDATQPPGTRDPLCLKLLVAQDDAVFLLKENATDLRKDPKALALLREKLFVLWGNLEELKASGSDEMPTNTAFECCIKEYGVKVDDEYVRVHRLFGLTIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.19
4 0.2
5 0.2
6 0.19
7 0.22
8 0.25
9 0.24
10 0.28
11 0.24
12 0.27
13 0.27
14 0.27
15 0.26
16 0.22
17 0.24
18 0.21
19 0.21
20 0.2
21 0.22
22 0.23
23 0.22
24 0.29
25 0.27
26 0.29
27 0.29
28 0.31
29 0.29
30 0.28
31 0.27
32 0.21
33 0.19
34 0.17
35 0.15
36 0.11
37 0.11
38 0.1
39 0.11
40 0.09
41 0.09
42 0.1
43 0.2
44 0.24
45 0.27
46 0.29
47 0.29
48 0.32
49 0.32
50 0.35
51 0.31
52 0.27
53 0.24
54 0.22
55 0.26
56 0.26
57 0.26
58 0.23
59 0.21
60 0.22
61 0.26
62 0.26
63 0.23
64 0.21
65 0.22
66 0.22
67 0.2
68 0.18
69 0.15
70 0.17
71 0.17
72 0.2
73 0.19
74 0.18
75 0.17
76 0.19
77 0.21
78 0.22
79 0.23
80 0.19
81 0.21
82 0.23
83 0.23
84 0.22
85 0.2
86 0.16
87 0.17
88 0.17
89 0.13
90 0.12
91 0.11
92 0.12
93 0.12
94 0.12
95 0.1
96 0.13
97 0.13
98 0.12
99 0.14
100 0.15
101 0.17
102 0.17
103 0.17
104 0.15
105 0.14
106 0.16
107 0.13
108 0.15
109 0.13
110 0.13
111 0.14
112 0.14
113 0.16
114 0.17
115 0.17
116 0.13
117 0.14
118 0.13
119 0.13
120 0.2
121 0.2
122 0.21
123 0.22
124 0.22
125 0.21
126 0.22
127 0.21
128 0.13
129 0.11
130 0.09
131 0.07
132 0.06
133 0.06
134 0.06
135 0.06
136 0.12
137 0.11
138 0.11
139 0.12
140 0.12
141 0.12
142 0.14
143 0.15
144 0.17
145 0.21
146 0.22
147 0.25
148 0.32
149 0.4
150 0.45
151 0.51
152 0.52
153 0.56
154 0.6
155 0.58
156 0.54
157 0.45
158 0.42
159 0.35
160 0.3
161 0.21
162 0.17
163 0.16
164 0.14
165 0.14
166 0.09
167 0.09
168 0.09
169 0.11
170 0.1
171 0.11
172 0.14
173 0.16
174 0.16
175 0.19
176 0.18
177 0.16
178 0.16
179 0.16
180 0.15
181 0.16
182 0.16
183 0.14
184 0.14
185 0.13
186 0.16
187 0.18
188 0.19
189 0.17
190 0.18
191 0.18
192 0.2
193 0.22
194 0.19
195 0.19
196 0.15
197 0.16
198 0.19
199 0.18
200 0.17
201 0.16
202 0.23
203 0.3
204 0.36
205 0.36
206 0.38
207 0.41
208 0.47
209 0.51
210 0.46
211 0.39
212 0.39
213 0.43
214 0.42
215 0.48
216 0.47
217 0.45
218 0.46
219 0.49
220 0.48
221 0.49
222 0.54
223 0.47
224 0.47
225 0.44
226 0.42
227 0.42
228 0.44
229 0.46
230 0.42
231 0.43
232 0.38
233 0.41
234 0.45
235 0.46
236 0.47
237 0.42
238 0.38
239 0.38
240 0.42
241 0.42
242 0.45
243 0.45
244 0.37
245 0.35
246 0.37
247 0.39
248 0.37
249 0.39
250 0.41
251 0.42
252 0.5
253 0.57
254 0.64
255 0.68
256 0.75
257 0.79
258 0.81
259 0.88
260 0.9
261 0.9
262 0.9
263 0.88
264 0.86
265 0.82
266 0.8
267 0.77
268 0.73
269 0.68
270 0.66
271 0.63
272 0.57
273 0.55
274 0.51
275 0.49
276 0.48
277 0.49
278 0.47
279 0.44
280 0.45
281 0.42
282 0.36
283 0.29
284 0.23
285 0.19
286 0.15
287 0.16
288 0.16
289 0.15
290 0.16
291 0.18
292 0.21
293 0.28
294 0.3
295 0.31
296 0.29
297 0.28
298 0.28
299 0.29
300 0.26
301 0.18
302 0.13
303 0.15
304 0.17
305 0.17
306 0.2
307 0.19
308 0.2
309 0.23
310 0.23
311 0.19
312 0.18
313 0.19
314 0.18
315 0.17
316 0.15
317 0.13
318 0.12
319 0.12
320 0.11
321 0.1
322 0.09
323 0.09
324 0.1
325 0.13
326 0.15
327 0.17
328 0.23
329 0.26
330 0.3
331 0.32
332 0.36
333 0.37
334 0.44
335 0.45
336 0.48
337 0.44
338 0.42
339 0.42
340 0.38
341 0.34
342 0.28
343 0.28
344 0.2
345 0.21
346 0.2
347 0.19
348 0.19
349 0.21
350 0.18
351 0.18
352 0.18
353 0.19
354 0.22
355 0.24
356 0.26
357 0.25
358 0.26
359 0.29
360 0.29
361 0.3
362 0.31
363 0.29
364 0.26
365 0.25
366 0.23
367 0.22
368 0.19
369 0.19
370 0.16
371 0.18
372 0.2
373 0.19
374 0.21
375 0.2
376 0.24
377 0.22
378 0.23
379 0.24
380 0.24
381 0.24
382 0.23
383 0.21
384 0.18
385 0.16
386 0.13
387 0.11
388 0.11
389 0.12
390 0.15
391 0.15
392 0.17
393 0.2
394 0.22
395 0.22
396 0.25
397 0.28
398 0.31
399 0.32
400 0.3
401 0.27
402 0.3
403 0.32
404 0.3
405 0.25
406 0.2
407 0.19
408 0.19
409 0.19
410 0.13
411 0.1
412 0.07
413 0.1
414 0.09
415 0.09
416 0.11
417 0.16
418 0.17
419 0.19
420 0.22
421 0.27
422 0.29
423 0.31
424 0.31
425 0.31
426 0.37
427 0.38
428 0.42
429 0.42
430 0.47
431 0.46
432 0.47
433 0.42
434 0.34
435 0.34
436 0.28
437 0.22
438 0.17
439 0.17
440 0.19
441 0.19
442 0.19
443 0.17
444 0.15
445 0.13
446 0.11
447 0.11
448 0.09
449 0.09
450 0.11
451 0.13
452 0.14
453 0.15
454 0.15
455 0.16
456 0.15
457 0.15
458 0.14
459 0.14
460 0.16
461 0.17
462 0.19
463 0.19
464 0.21
465 0.23
466 0.29
467 0.3
468 0.28
469 0.26
470 0.31
471 0.32
472 0.31
473 0.32
474 0.29
475 0.31
476 0.31
477 0.3
478 0.26
479 0.25