Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7Z233

Protein Details
Accession R7Z233    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-27VYKATGKKLPHKAQKQYTSRKCMHHydrophilic
56-76IVKNKQKTTNAPRKGKPIRVQHydrophilic
NLS Segment(s)
PositionSequence
68-69RK
Subcellular Location(s) nucl 14.5, mito_nucl 11.5, mito 7.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000064  NLP_P60_dom  
IPR038765  Papain-like_cys_pep_sf  
Pfam View protein in Pfam  
PF00877  NLPC_P60  
Amino Acid Sequences MHAVYKATGKKLPHKAQKQYTSRKCMHVPLSQRKKGDLVFWGTNGNCKRAIKHVAIVKNKQKTTNAPRKGKPIRVQNH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.74
3 0.8
4 0.85
5 0.86
6 0.86
7 0.85
8 0.83
9 0.77
10 0.73
11 0.66
12 0.62
13 0.57
14 0.53
15 0.53
16 0.56
17 0.62
18 0.61
19 0.59
20 0.54
21 0.51
22 0.45
23 0.38
24 0.3
25 0.26
26 0.22
27 0.22
28 0.23
29 0.2
30 0.26
31 0.24
32 0.22
33 0.2
34 0.2
35 0.21
36 0.25
37 0.3
38 0.26
39 0.31
40 0.36
41 0.41
42 0.48
43 0.54
44 0.57
45 0.6
46 0.6
47 0.59
48 0.56
49 0.58
50 0.62
51 0.64
52 0.66
53 0.67
54 0.7
55 0.76
56 0.81
57 0.81
58 0.79