Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7Z780

Protein Details
Accession R7Z780    Localization Confidence High Confidence Score 21.9
NoLS Segment(s)
PositionSequenceProtein Nature
29-59VPNRSQKSAIKSKKAPPKRKKAEHSEGYGRDHydrophilic
80-103GLDTGDRPKNKKRKRGQETAEDAAHydrophilic
201-221ELPAKGKKGKRKRLIGEQPDGBasic
NLS Segment(s)
PositionSequence
32-50RSQKSAIKSKKAPPKRKKA
86-95RPKNKKRKRG
204-213AKGKKGKRKR
Subcellular Location(s) nucl 17.5, mito_nucl 10, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR038871  C607.02c-like  
Amino Acid Sequences MPHKHTRTKGQDVESYDLPPSAFAKPLPVPNRSQKSAIKSKKAPPKRKKAEHSEGYGRDDTPKAFARLMQFQATGKGLRGLDTGDRPKNKKRKRGQETAEDAAEKPEKPSLEMPKILPGERMSDFAARVDQALPVSGLARKGGNVAGIKERQTKTEKRLQKMYAEWRRGEARIREKEEEARELAEEEDDEQAVMFEDKTAELPAKGKKGKRKRLIGEQPDGDDDPWAVLQASREQPKGLHDVAQAPPQFKSLPTEKFKVRNGAKVTVGDVPNAAGSLRRREELGEARKSIIEQYRKLMESKRNGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.49
3 0.4
4 0.33
5 0.27
6 0.23
7 0.2
8 0.16
9 0.16
10 0.14
11 0.2
12 0.23
13 0.32
14 0.35
15 0.37
16 0.42
17 0.51
18 0.59
19 0.56
20 0.58
21 0.55
22 0.59
23 0.66
24 0.69
25 0.68
26 0.67
27 0.73
28 0.78
29 0.83
30 0.85
31 0.84
32 0.87
33 0.88
34 0.91
35 0.92
36 0.92
37 0.91
38 0.88
39 0.85
40 0.83
41 0.75
42 0.71
43 0.63
44 0.52
45 0.45
46 0.39
47 0.32
48 0.27
49 0.28
50 0.25
51 0.23
52 0.25
53 0.27
54 0.31
55 0.34
56 0.31
57 0.28
58 0.26
59 0.28
60 0.27
61 0.23
62 0.17
63 0.19
64 0.16
65 0.16
66 0.16
67 0.15
68 0.17
69 0.23
70 0.29
71 0.32
72 0.38
73 0.42
74 0.51
75 0.61
76 0.66
77 0.7
78 0.73
79 0.78
80 0.8
81 0.86
82 0.82
83 0.82
84 0.8
85 0.73
86 0.65
87 0.54
88 0.45
89 0.38
90 0.34
91 0.24
92 0.18
93 0.17
94 0.15
95 0.17
96 0.23
97 0.26
98 0.29
99 0.31
100 0.31
101 0.35
102 0.36
103 0.34
104 0.3
105 0.23
106 0.23
107 0.21
108 0.22
109 0.17
110 0.16
111 0.16
112 0.14
113 0.14
114 0.1
115 0.1
116 0.09
117 0.08
118 0.07
119 0.07
120 0.07
121 0.06
122 0.07
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.07
129 0.08
130 0.1
131 0.1
132 0.11
133 0.14
134 0.15
135 0.17
136 0.24
137 0.24
138 0.25
139 0.3
140 0.33
141 0.34
142 0.42
143 0.47
144 0.44
145 0.51
146 0.49
147 0.47
148 0.49
149 0.54
150 0.54
151 0.51
152 0.47
153 0.43
154 0.44
155 0.41
156 0.4
157 0.36
158 0.37
159 0.41
160 0.45
161 0.45
162 0.44
163 0.49
164 0.46
165 0.42
166 0.33
167 0.26
168 0.21
169 0.19
170 0.17
171 0.11
172 0.09
173 0.07
174 0.07
175 0.06
176 0.06
177 0.05
178 0.05
179 0.05
180 0.05
181 0.04
182 0.04
183 0.04
184 0.05
185 0.06
186 0.06
187 0.07
188 0.07
189 0.11
190 0.14
191 0.22
192 0.27
193 0.32
194 0.42
195 0.52
196 0.62
197 0.69
198 0.75
199 0.74
200 0.79
201 0.85
202 0.83
203 0.8
204 0.71
205 0.63
206 0.56
207 0.5
208 0.39
209 0.28
210 0.2
211 0.13
212 0.1
213 0.09
214 0.06
215 0.06
216 0.08
217 0.14
218 0.2
219 0.23
220 0.24
221 0.24
222 0.25
223 0.28
224 0.32
225 0.26
226 0.24
227 0.22
228 0.27
229 0.29
230 0.34
231 0.33
232 0.29
233 0.28
234 0.26
235 0.25
236 0.21
237 0.24
238 0.25
239 0.32
240 0.36
241 0.41
242 0.46
243 0.52
244 0.57
245 0.61
246 0.58
247 0.57
248 0.57
249 0.57
250 0.53
251 0.47
252 0.45
253 0.42
254 0.38
255 0.3
256 0.25
257 0.21
258 0.18
259 0.16
260 0.14
261 0.11
262 0.14
263 0.22
264 0.25
265 0.25
266 0.26
267 0.27
268 0.35
269 0.4
270 0.46
271 0.45
272 0.44
273 0.45
274 0.45
275 0.44
276 0.43
277 0.42
278 0.41
279 0.36
280 0.41
281 0.46
282 0.47
283 0.5
284 0.51
285 0.52