Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YLC6

Protein Details
Accession R7YLC6    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
94-121QGPFESMKAKRAKRKAEKALKKAKKAVVHydrophilic
NLS Segment(s)
PositionSequence
23-90KRAKLRAAAALLKARSKIEPILAKADPTHQPAARRLRAREKAAVLRARARGKKLLVKEDKAEEKAERA
98-119ESMKAKRAKRKAEKALKKAKKA
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MSTVNTGDAAPSAVPAGNLHIGKRAKLRAAAALLKARSKIEPILAKADPTHQPAARRLRAREKAAVLRARARGKKLLVKEDKAEEKAERALSVQGPFESMKAKRAKRKAEKALKKAKKAVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.11
4 0.15
5 0.15
6 0.16
7 0.22
8 0.23
9 0.25
10 0.31
11 0.32
12 0.29
13 0.32
14 0.33
15 0.3
16 0.34
17 0.34
18 0.32
19 0.33
20 0.31
21 0.3
22 0.29
23 0.26
24 0.22
25 0.21
26 0.19
27 0.19
28 0.22
29 0.23
30 0.27
31 0.26
32 0.26
33 0.24
34 0.27
35 0.24
36 0.23
37 0.25
38 0.21
39 0.24
40 0.3
41 0.38
42 0.4
43 0.41
44 0.41
45 0.47
46 0.52
47 0.53
48 0.5
49 0.46
50 0.44
51 0.47
52 0.46
53 0.38
54 0.37
55 0.39
56 0.42
57 0.41
58 0.39
59 0.38
60 0.38
61 0.43
62 0.42
63 0.46
64 0.46
65 0.46
66 0.46
67 0.48
68 0.49
69 0.44
70 0.42
71 0.33
72 0.29
73 0.3
74 0.27
75 0.21
76 0.17
77 0.18
78 0.18
79 0.19
80 0.18
81 0.14
82 0.16
83 0.16
84 0.16
85 0.18
86 0.17
87 0.23
88 0.31
89 0.38
90 0.46
91 0.55
92 0.65
93 0.71
94 0.81
95 0.84
96 0.87
97 0.9
98 0.91
99 0.93
100 0.91
101 0.89