Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7Z181

Protein Details
Accession R7Z181   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
29-55VPKTRRTYCKGKDCKKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MDLTGRWEYAGIEKLRAVMLIQWFLQVNVPKTRRTYCKGKDCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.2
4 0.17
5 0.13
6 0.15
7 0.16
8 0.15
9 0.16
10 0.16
11 0.16
12 0.2
13 0.2
14 0.21
15 0.28
16 0.3
17 0.31
18 0.36
19 0.42
20 0.44
21 0.47
22 0.53
23 0.53
24 0.62
25 0.7
26 0.75
27 0.79
28 0.8
29 0.85
30 0.84
31 0.85
32 0.84
33 0.84
34 0.82
35 0.83
36 0.85
37 0.77
38 0.76
39 0.69
40 0.63
41 0.55
42 0.49
43 0.39
44 0.3
45 0.29
46 0.29
47 0.28
48 0.25
49 0.3
50 0.34
51 0.37
52 0.41
53 0.45
54 0.42
55 0.49
56 0.56
57 0.54
58 0.56
59 0.55
60 0.56
61 0.55
62 0.58
63 0.5
64 0.45
65 0.42
66 0.35
67 0.38
68 0.4
69 0.39
70 0.34
71 0.41
72 0.45
73 0.53
74 0.62
75 0.65
76 0.64
77 0.68
78 0.74
79 0.75
80 0.73
81 0.7
82 0.66
83 0.63
84 0.62
85 0.57
86 0.52
87 0.48
88 0.43
89 0.38
90 0.35
91 0.34
92 0.37
93 0.43
94 0.46
95 0.51
96 0.6
97 0.66
98 0.71
99 0.69
100 0.63
101 0.57
102 0.52
103 0.5
104 0.5
105 0.51
106 0.52
107 0.55
108 0.52
109 0.5
110 0.49
111 0.42