Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0CSK3

Protein Details
Accession B0CSK3    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-60AKVFRFCTSKCHKNFKMKRNPRKVRWTKAFRKAAGHydrophilic
NLS Segment(s)
PositionSequence
41-59KMKRNPRKVRWTKAFRKAA
94-125KRVGEIKARRERAFYKNRMAASREKQRAHRKK
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 10, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
IPR011017  TRASH_dom  
KEGG lbc:LACBIDRAFT_182124  -  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRIEKCYFCSTNVYPGHGSAFVRNDAKVFRFCTSKCHKNFKMKRNPRKVRWTKAFRKAAGKEMTIDSTIDFEKRRNVPVRYDRELVQTTVKAMKRVGEIKARRERAFYKNRMAASREKQRAHRKKMLEQAKSSVTLHEPLAVEEAESINESKKIKLTVNSKHKSALVPGEGRSMGMDID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.35
4 0.29
5 0.28
6 0.23
7 0.24
8 0.24
9 0.25
10 0.24
11 0.24
12 0.24
13 0.27
14 0.26
15 0.26
16 0.25
17 0.29
18 0.29
19 0.37
20 0.43
21 0.49
22 0.53
23 0.6
24 0.65
25 0.71
26 0.8
27 0.81
28 0.84
29 0.85
30 0.89
31 0.9
32 0.92
33 0.9
34 0.92
35 0.91
36 0.9
37 0.89
38 0.89
39 0.87
40 0.88
41 0.87
42 0.79
43 0.78
44 0.7
45 0.68
46 0.61
47 0.52
48 0.44
49 0.37
50 0.35
51 0.26
52 0.24
53 0.15
54 0.13
55 0.12
56 0.12
57 0.11
58 0.1
59 0.16
60 0.18
61 0.24
62 0.29
63 0.31
64 0.38
65 0.46
66 0.53
67 0.51
68 0.51
69 0.45
70 0.44
71 0.43
72 0.36
73 0.28
74 0.21
75 0.17
76 0.21
77 0.21
78 0.17
79 0.16
80 0.17
81 0.19
82 0.21
83 0.23
84 0.26
85 0.29
86 0.37
87 0.45
88 0.48
89 0.45
90 0.46
91 0.48
92 0.49
93 0.55
94 0.52
95 0.5
96 0.51
97 0.52
98 0.51
99 0.49
100 0.48
101 0.46
102 0.51
103 0.51
104 0.5
105 0.57
106 0.65
107 0.73
108 0.74
109 0.74
110 0.69
111 0.7
112 0.76
113 0.76
114 0.71
115 0.64
116 0.6
117 0.54
118 0.51
119 0.43
120 0.35
121 0.28
122 0.23
123 0.21
124 0.2
125 0.17
126 0.15
127 0.17
128 0.15
129 0.13
130 0.11
131 0.12
132 0.08
133 0.09
134 0.09
135 0.08
136 0.12
137 0.13
138 0.14
139 0.17
140 0.2
141 0.23
142 0.31
143 0.38
144 0.45
145 0.55
146 0.59
147 0.57
148 0.57
149 0.55
150 0.5
151 0.46
152 0.43
153 0.39
154 0.38
155 0.37
156 0.39
157 0.36
158 0.34
159 0.3