Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3BTS6

Protein Details
Accession S3BTS6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
37-64YGLEKQEKKKTPKGRAKKRLTYTRRFVNHydrophilic
NLS Segment(s)
PositionSequence
43-55EKKKTPKGRAKKR
Subcellular Location(s) mito 13, cyto_nucl 7, nucl 6.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MTDSIRPVPNDRWCPAGYPATELEDWTEDQATFTLAYGLEKQEKKKTPKGRAKKRLTYTRRFVNVTLTGGKRKMNPNPGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.41
4 0.32
5 0.28
6 0.28
7 0.27
8 0.26
9 0.23
10 0.2
11 0.16
12 0.16
13 0.13
14 0.13
15 0.09
16 0.1
17 0.09
18 0.08
19 0.07
20 0.06
21 0.06
22 0.05
23 0.06
24 0.07
25 0.08
26 0.13
27 0.15
28 0.18
29 0.25
30 0.32
31 0.38
32 0.46
33 0.54
34 0.59
35 0.68
36 0.77
37 0.8
38 0.84
39 0.88
40 0.88
41 0.88
42 0.89
43 0.86
44 0.85
45 0.81
46 0.8
47 0.76
48 0.69
49 0.59
50 0.56
51 0.51
52 0.45
53 0.43
54 0.37
55 0.36
56 0.36
57 0.38
58 0.38
59 0.42
60 0.48
61 0.52