Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3BXV9

Protein Details
Accession S3BXV9    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
2-28VSAKKHVPIIKKRTKHFSRHQSDRFMRHydrophilic
NLS Segment(s)
PositionSequence
10-22IIKKRTKHFSRHQ
25-25R
27-46MRVGSSWRKPKGIDSRVRRR
Subcellular Location(s) mito 19.5, mito_nucl 12.333, cyto_nucl 4.333, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIIKKRTKHFSRHQSDRFMRVGSSWRKPKGIDSRVRRRFRGQQVLPSIGFGSNKKTRHMTPSGHKAFLVSNVNDVELLLMHNRTYAAEIAHNVSSRKRVDIIARAKQLGVKVTNVKAKVTTEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.81
4 0.81
5 0.82
6 0.81
7 0.84
8 0.83
9 0.83
10 0.79
11 0.75
12 0.67
13 0.57
14 0.47
15 0.38
16 0.41
17 0.37
18 0.42
19 0.44
20 0.45
21 0.46
22 0.47
23 0.54
24 0.56
25 0.57
26 0.58
27 0.59
28 0.67
29 0.75
30 0.8
31 0.74
32 0.7
33 0.71
34 0.71
35 0.72
36 0.63
37 0.61
38 0.61
39 0.61
40 0.54
41 0.45
42 0.36
43 0.26
44 0.24
45 0.16
46 0.18
47 0.2
48 0.21
49 0.23
50 0.25
51 0.26
52 0.31
53 0.35
54 0.34
55 0.35
56 0.45
57 0.46
58 0.43
59 0.42
60 0.36
61 0.31
62 0.31
63 0.29
64 0.18
65 0.17
66 0.17
67 0.17
68 0.16
69 0.15
70 0.1
71 0.06
72 0.07
73 0.05
74 0.06
75 0.05
76 0.06
77 0.06
78 0.07
79 0.08
80 0.08
81 0.08
82 0.09
83 0.11
84 0.13
85 0.15
86 0.16
87 0.16
88 0.17
89 0.22
90 0.22
91 0.23
92 0.22
93 0.23
94 0.28
95 0.36
96 0.43
97 0.46
98 0.49
99 0.48
100 0.46
101 0.45
102 0.42
103 0.38
104 0.32
105 0.28
106 0.31
107 0.36
108 0.42
109 0.41
110 0.4
111 0.37