Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3BS89

Protein Details
Accession S3BS89    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
62-88QAYRDCKKIWLNKRQEDKRKAAKKGWFHydrophilic
NLS Segment(s)
PositionSequence
79-85KRKAAKK
Subcellular Location(s) nucl 19.5, cyto_nucl 11, pero 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSDSSGNGADSAKTPWNPKVREKFETKSKSEYLDPCQEAAAKSIRCLHRNGGDRGMCQDYFQAYRDCKKIWLNKRQEDKRKAAKKGWFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.3
3 0.38
4 0.41
5 0.5
6 0.57
7 0.58
8 0.62
9 0.65
10 0.65
11 0.66
12 0.7
13 0.63
14 0.59
15 0.53
16 0.5
17 0.49
18 0.46
19 0.41
20 0.41
21 0.39
22 0.33
23 0.32
24 0.3
25 0.25
26 0.23
27 0.22
28 0.14
29 0.15
30 0.21
31 0.24
32 0.24
33 0.26
34 0.27
35 0.29
36 0.35
37 0.36
38 0.37
39 0.35
40 0.34
41 0.36
42 0.36
43 0.29
44 0.23
45 0.22
46 0.17
47 0.17
48 0.19
49 0.2
50 0.19
51 0.24
52 0.27
53 0.27
54 0.29
55 0.36
56 0.44
57 0.49
58 0.57
59 0.62
60 0.68
61 0.78
62 0.84
63 0.87
64 0.86
65 0.86
66 0.86
67 0.86
68 0.84
69 0.81