Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CL71

Protein Details
Accession S3CL71   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKSARASSRKANNQKLKRNVFGHydrophilic
80-104AVKIVSSKKRIEKRRSVKKGSIVFPHydrophilic
NLS Segment(s)
PositionSequence
86-116SKKRIEKRRSVKKGSIVFPRYKDRKNTTRRK
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Gene Ontology GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSARASSRKANNQKLKRNVFGPVETARTDRLSAKLMELVAQAKPAHEEKKEEEVMEEDPTPSDQLKEEASAMDVDAGAVKIVSSKKRIEKRRSVKKGSIVFPRYKDRKNTTRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.87
3 0.89
4 0.86
5 0.8
6 0.72
7 0.68
8 0.61
9 0.53
10 0.47
11 0.39
12 0.35
13 0.31
14 0.3
15 0.25
16 0.22
17 0.22
18 0.2
19 0.19
20 0.19
21 0.18
22 0.18
23 0.18
24 0.16
25 0.16
26 0.15
27 0.14
28 0.11
29 0.13
30 0.12
31 0.1
32 0.12
33 0.14
34 0.16
35 0.16
36 0.19
37 0.2
38 0.27
39 0.28
40 0.25
41 0.23
42 0.21
43 0.21
44 0.2
45 0.16
46 0.1
47 0.09
48 0.09
49 0.09
50 0.08
51 0.07
52 0.06
53 0.07
54 0.08
55 0.09
56 0.09
57 0.08
58 0.09
59 0.08
60 0.08
61 0.06
62 0.05
63 0.05
64 0.05
65 0.05
66 0.04
67 0.03
68 0.03
69 0.06
70 0.1
71 0.13
72 0.16
73 0.22
74 0.32
75 0.41
76 0.52
77 0.58
78 0.66
79 0.74
80 0.82
81 0.87
82 0.86
83 0.84
84 0.83
85 0.82
86 0.77
87 0.77
88 0.72
89 0.69
90 0.66
91 0.7
92 0.68
93 0.67
94 0.7
95 0.69
96 0.73