Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3C2D5

Protein Details
Accession S3C2D5   
Localization Confidence High
Confidence Score 21.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MPSLSQRPRRRPAQNDHEDEPPRRRRKTPVEEEEEEBasic
62-98EEEEEPPRSRRQRQSQSQRRRPRDSGRRRQNEEESEDBasic
188-207MSVRERRKALKTKKQQPAGPHydrophilic
NLS Segment(s)
PositionSequence
24-25RR
71-89RRQRQSQSQRRRPRDSGRR
193-201RRKALKTKK
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR037445  MAGE  
IPR041898  MAGE_WH1  
IPR041899  MAGE_WH2  
IPR002190  MHD_dom  
Pfam View protein in Pfam  
PF01454  MAGE  
Amino Acid Sequences MPSLSQRPRRRPAQNDHEDEPPRRRRKTPVEEEEEEEEEDEQEEDEAEDDDEEVEEEDAEEEEEEEPPRSRRQRQSQSQRRRPRDSGRRRQNEEESEDGDGDEEDGDMPQTQANRQQLHQQLLAKKLVRYALACEPRRVPIRRQAVKEHVLDNEGKHFRVVFPIAQTQLREIFGMELVEWPARDETTMSVRERRKALKTKKQQPAGPQGTQRKAAAAPPVQRMDRYALLSTLPETYREAVFAPIPVENSARNPPASDAAYMGFCTLVVSLITLSGGSMPHGDLEKYLGLLHGTSHHIVRADEDFMKPMAAMMGDHVDDDDGGAGGTSQTQDGDSVIQGGTLQHLVRQGYVVRVVEEATAGGSSVHGGAKVTWHVGPRGRLEIGPAEVASVVRHIYGPDANEEMEQQLQSSLRAATNAAKKGEKKSSGGRIEQEQQRQRDEDEEDAAAED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.85
3 0.79
4 0.78
5 0.74
6 0.71
7 0.7
8 0.69
9 0.68
10 0.67
11 0.69
12 0.71
13 0.75
14 0.8
15 0.81
16 0.81
17 0.81
18 0.78
19 0.78
20 0.72
21 0.63
22 0.52
23 0.41
24 0.31
25 0.22
26 0.19
27 0.14
28 0.1
29 0.08
30 0.08
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.07
47 0.06
48 0.07
49 0.07
50 0.09
51 0.1
52 0.11
53 0.14
54 0.16
55 0.25
56 0.32
57 0.41
58 0.5
59 0.6
60 0.69
61 0.78
62 0.87
63 0.89
64 0.92
65 0.94
66 0.95
67 0.93
68 0.91
69 0.88
70 0.88
71 0.88
72 0.88
73 0.88
74 0.88
75 0.89
76 0.87
77 0.87
78 0.85
79 0.81
80 0.75
81 0.68
82 0.58
83 0.5
84 0.43
85 0.34
86 0.26
87 0.18
88 0.13
89 0.09
90 0.07
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.07
97 0.08
98 0.09
99 0.16
100 0.22
101 0.24
102 0.25
103 0.33
104 0.37
105 0.41
106 0.43
107 0.43
108 0.41
109 0.43
110 0.48
111 0.41
112 0.36
113 0.35
114 0.33
115 0.29
116 0.25
117 0.25
118 0.29
119 0.36
120 0.37
121 0.37
122 0.37
123 0.41
124 0.48
125 0.47
126 0.43
127 0.43
128 0.52
129 0.56
130 0.59
131 0.61
132 0.6
133 0.62
134 0.6
135 0.53
136 0.43
137 0.38
138 0.35
139 0.28
140 0.29
141 0.25
142 0.22
143 0.21
144 0.2
145 0.18
146 0.2
147 0.22
148 0.14
149 0.16
150 0.19
151 0.2
152 0.21
153 0.21
154 0.19
155 0.19
156 0.18
157 0.15
158 0.12
159 0.11
160 0.1
161 0.09
162 0.08
163 0.07
164 0.07
165 0.07
166 0.07
167 0.07
168 0.07
169 0.07
170 0.07
171 0.07
172 0.07
173 0.12
174 0.16
175 0.17
176 0.24
177 0.26
178 0.3
179 0.34
180 0.37
181 0.41
182 0.48
183 0.56
184 0.6
185 0.68
186 0.74
187 0.79
188 0.81
189 0.75
190 0.72
191 0.73
192 0.68
193 0.61
194 0.58
195 0.57
196 0.53
197 0.51
198 0.44
199 0.35
200 0.29
201 0.27
202 0.26
203 0.23
204 0.25
205 0.27
206 0.3
207 0.28
208 0.28
209 0.27
210 0.25
211 0.22
212 0.2
213 0.16
214 0.13
215 0.13
216 0.13
217 0.13
218 0.12
219 0.1
220 0.09
221 0.09
222 0.1
223 0.1
224 0.11
225 0.1
226 0.09
227 0.09
228 0.09
229 0.09
230 0.08
231 0.09
232 0.09
233 0.09
234 0.09
235 0.11
236 0.14
237 0.15
238 0.14
239 0.14
240 0.14
241 0.16
242 0.17
243 0.14
244 0.12
245 0.11
246 0.11
247 0.11
248 0.1
249 0.07
250 0.06
251 0.05
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.04
259 0.03
260 0.03
261 0.04
262 0.04
263 0.04
264 0.05
265 0.05
266 0.06
267 0.07
268 0.07
269 0.06
270 0.08
271 0.08
272 0.08
273 0.08
274 0.07
275 0.07
276 0.07
277 0.07
278 0.08
279 0.1
280 0.1
281 0.11
282 0.12
283 0.12
284 0.12
285 0.14
286 0.13
287 0.14
288 0.15
289 0.15
290 0.15
291 0.14
292 0.14
293 0.12
294 0.1
295 0.08
296 0.06
297 0.06
298 0.05
299 0.07
300 0.07
301 0.07
302 0.07
303 0.06
304 0.06
305 0.06
306 0.05
307 0.03
308 0.03
309 0.03
310 0.03
311 0.03
312 0.04
313 0.04
314 0.04
315 0.04
316 0.05
317 0.05
318 0.06
319 0.07
320 0.06
321 0.07
322 0.07
323 0.07
324 0.07
325 0.07
326 0.07
327 0.08
328 0.08
329 0.09
330 0.12
331 0.12
332 0.12
333 0.14
334 0.14
335 0.14
336 0.18
337 0.17
338 0.14
339 0.14
340 0.15
341 0.13
342 0.12
343 0.1
344 0.07
345 0.06
346 0.05
347 0.05
348 0.04
349 0.05
350 0.06
351 0.06
352 0.06
353 0.07
354 0.07
355 0.09
356 0.11
357 0.13
358 0.14
359 0.16
360 0.2
361 0.24
362 0.29
363 0.3
364 0.33
365 0.32
366 0.3
367 0.31
368 0.3
369 0.27
370 0.24
371 0.2
372 0.16
373 0.15
374 0.15
375 0.12
376 0.1
377 0.08
378 0.07
379 0.08
380 0.08
381 0.1
382 0.13
383 0.14
384 0.16
385 0.17
386 0.17
387 0.17
388 0.18
389 0.16
390 0.16
391 0.15
392 0.12
393 0.13
394 0.13
395 0.13
396 0.14
397 0.15
398 0.13
399 0.14
400 0.15
401 0.2
402 0.28
403 0.33
404 0.35
405 0.39
406 0.42
407 0.5
408 0.58
409 0.55
410 0.53
411 0.56
412 0.63
413 0.64
414 0.66
415 0.62
416 0.59
417 0.64
418 0.67
419 0.68
420 0.66
421 0.63
422 0.63
423 0.61
424 0.56
425 0.53
426 0.49
427 0.42
428 0.37
429 0.33