Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3D0C3

Protein Details
Accession S3D0C3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
84-108RCISVPTMRRWRRPSSRSKPRFEPGHydrophilic
NLS Segment(s)
PositionSequence
94-104WRRPSSRSKPR
Subcellular Location(s) cyto 18, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR010799  MlrC_C  
Pfam View protein in Pfam  
PF07171  MlrC_C  
Amino Acid Sequences MGHDPHAALAAHKAGVCALVTLDLGGRHGPEGRTIGRRSIRLGPTAVLTIGGVEVIVGSERMRPYDMMAFQHLGVEPEYGAGVRCISVPTMRRWRRPSSRSKPRFEPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.11
4 0.08
5 0.07
6 0.06
7 0.06
8 0.06
9 0.07
10 0.06
11 0.07
12 0.07
13 0.07
14 0.07
15 0.1
16 0.1
17 0.11
18 0.14
19 0.17
20 0.22
21 0.23
22 0.29
23 0.31
24 0.32
25 0.33
26 0.38
27 0.37
28 0.33
29 0.33
30 0.27
31 0.24
32 0.23
33 0.19
34 0.11
35 0.09
36 0.06
37 0.05
38 0.04
39 0.03
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.03
46 0.05
47 0.06
48 0.07
49 0.08
50 0.08
51 0.1
52 0.14
53 0.16
54 0.15
55 0.17
56 0.17
57 0.17
58 0.18
59 0.16
60 0.13
61 0.11
62 0.1
63 0.08
64 0.07
65 0.07
66 0.06
67 0.06
68 0.06
69 0.05
70 0.05
71 0.06
72 0.06
73 0.08
74 0.12
75 0.15
76 0.24
77 0.35
78 0.42
79 0.51
80 0.56
81 0.66
82 0.72
83 0.77
84 0.8
85 0.8
86 0.85
87 0.85
88 0.87