Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3BX49

Protein Details
Accession S3BX49    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
60-81INKAYRKKTRSLHPDKVKQQLAHydrophilic
410-429QTTGSSHNKVKANKRKGKKKBasic
NLS Segment(s)
PositionSequence
418-429KVKANKRKGKKK
Subcellular Location(s) extr 13, mito 4, cyto 3, mito_nucl 3, nucl 2, pero 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MKVWTTIIGLLAVLTPLTAAWSKEDREIFRVRDELATALGPDVTFYDFVGVSSSASLDDINKAYRKKTRSLHPDKVKQQLAAERAKTAKKNGGVPVTKQPSSGEVRAAVKRASDMQARLGIVTNILRGPERDRYDHFLSNGFPTWKGTEYYYNRYRPGFGTVMVGLFVFIGGAIHYLTLYMGWKRQREFVDRYIRYARQAAWGNQLAGMDLNAIGTDPTAAPAAEEEAGSDAQQQQMAMNRKQRRMQERDAKRDAAKDGNTTSRRGRRGVAGAGAASSGTATPTPQAAAGPTGAKRRVTAENGKVLVVDSLGDVYLEQMDAEGKVEELLLDINEVVRPTIFDTAVYRLPAWAFSLTVGRVFAKKTADEDEFVSGAANDDDSSSDSSPGKATPSSDSQDEFEVVEKSGAAQTTGSSHNKVKANKRKGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.07
5 0.08
6 0.09
7 0.14
8 0.18
9 0.2
10 0.27
11 0.33
12 0.33
13 0.38
14 0.44
15 0.42
16 0.42
17 0.43
18 0.38
19 0.34
20 0.33
21 0.28
22 0.22
23 0.2
24 0.16
25 0.14
26 0.13
27 0.1
28 0.09
29 0.09
30 0.09
31 0.09
32 0.08
33 0.1
34 0.09
35 0.1
36 0.12
37 0.11
38 0.1
39 0.1
40 0.1
41 0.08
42 0.08
43 0.09
44 0.07
45 0.1
46 0.12
47 0.16
48 0.21
49 0.23
50 0.29
51 0.36
52 0.4
53 0.45
54 0.51
55 0.57
56 0.64
57 0.72
58 0.77
59 0.8
60 0.85
61 0.84
62 0.85
63 0.78
64 0.69
65 0.64
66 0.59
67 0.55
68 0.53
69 0.47
70 0.42
71 0.43
72 0.46
73 0.45
74 0.43
75 0.44
76 0.41
77 0.45
78 0.47
79 0.51
80 0.49
81 0.49
82 0.54
83 0.54
84 0.5
85 0.45
86 0.4
87 0.36
88 0.39
89 0.36
90 0.28
91 0.25
92 0.3
93 0.31
94 0.33
95 0.28
96 0.22
97 0.22
98 0.23
99 0.23
100 0.23
101 0.22
102 0.23
103 0.26
104 0.26
105 0.25
106 0.22
107 0.18
108 0.15
109 0.15
110 0.13
111 0.1
112 0.1
113 0.1
114 0.1
115 0.14
116 0.21
117 0.24
118 0.26
119 0.29
120 0.36
121 0.41
122 0.42
123 0.39
124 0.34
125 0.31
126 0.31
127 0.31
128 0.24
129 0.2
130 0.18
131 0.19
132 0.19
133 0.18
134 0.18
135 0.24
136 0.27
137 0.36
138 0.41
139 0.43
140 0.44
141 0.44
142 0.43
143 0.35
144 0.36
145 0.28
146 0.21
147 0.2
148 0.18
149 0.17
150 0.15
151 0.14
152 0.08
153 0.07
154 0.06
155 0.03
156 0.03
157 0.02
158 0.02
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.05
167 0.05
168 0.1
169 0.14
170 0.17
171 0.19
172 0.25
173 0.28
174 0.33
175 0.38
176 0.42
177 0.49
178 0.46
179 0.5
180 0.49
181 0.46
182 0.42
183 0.39
184 0.31
185 0.27
186 0.3
187 0.28
188 0.28
189 0.28
190 0.27
191 0.25
192 0.24
193 0.17
194 0.13
195 0.11
196 0.06
197 0.04
198 0.04
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.03
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.05
211 0.05
212 0.05
213 0.04
214 0.05
215 0.06
216 0.06
217 0.07
218 0.06
219 0.06
220 0.07
221 0.07
222 0.06
223 0.13
224 0.19
225 0.22
226 0.3
227 0.35
228 0.4
229 0.45
230 0.51
231 0.54
232 0.57
233 0.62
234 0.64
235 0.68
236 0.72
237 0.72
238 0.68
239 0.6
240 0.56
241 0.48
242 0.44
243 0.36
244 0.29
245 0.27
246 0.32
247 0.32
248 0.32
249 0.37
250 0.38
251 0.4
252 0.39
253 0.38
254 0.34
255 0.37
256 0.36
257 0.31
258 0.24
259 0.21
260 0.19
261 0.17
262 0.12
263 0.08
264 0.06
265 0.04
266 0.04
267 0.04
268 0.04
269 0.05
270 0.05
271 0.06
272 0.06
273 0.06
274 0.06
275 0.07
276 0.08
277 0.1
278 0.12
279 0.17
280 0.19
281 0.2
282 0.2
283 0.23
284 0.28
285 0.32
286 0.38
287 0.38
288 0.42
289 0.42
290 0.41
291 0.37
292 0.32
293 0.26
294 0.17
295 0.12
296 0.05
297 0.05
298 0.05
299 0.05
300 0.04
301 0.04
302 0.05
303 0.04
304 0.04
305 0.04
306 0.04
307 0.05
308 0.06
309 0.05
310 0.05
311 0.05
312 0.05
313 0.05
314 0.05
315 0.05
316 0.04
317 0.05
318 0.05
319 0.05
320 0.06
321 0.06
322 0.06
323 0.06
324 0.06
325 0.08
326 0.11
327 0.11
328 0.11
329 0.13
330 0.17
331 0.19
332 0.2
333 0.18
334 0.16
335 0.17
336 0.17
337 0.16
338 0.13
339 0.11
340 0.11
341 0.14
342 0.13
343 0.14
344 0.14
345 0.14
346 0.15
347 0.16
348 0.18
349 0.19
350 0.2
351 0.22
352 0.26
353 0.27
354 0.26
355 0.27
356 0.26
357 0.23
358 0.22
359 0.19
360 0.13
361 0.12
362 0.11
363 0.09
364 0.06
365 0.07
366 0.07
367 0.09
368 0.13
369 0.12
370 0.15
371 0.16
372 0.16
373 0.17
374 0.18
375 0.19
376 0.17
377 0.18
378 0.21
379 0.26
380 0.29
381 0.31
382 0.32
383 0.3
384 0.31
385 0.3
386 0.25
387 0.21
388 0.18
389 0.17
390 0.15
391 0.13
392 0.12
393 0.14
394 0.14
395 0.12
396 0.11
397 0.11
398 0.15
399 0.21
400 0.23
401 0.25
402 0.29
403 0.36
404 0.42
405 0.5
406 0.57
407 0.62
408 0.7
409 0.76