Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3C5W1

Protein Details
Accession S3C5W1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-29IRTHHITSRKKVQRVRRAASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
Amino Acid Sequences MSRPLFNCLIRTHHITSRKKVQRVRRAASQFDVDWVLIRYGGSPGIMFGEAHDATALTEWVAAVKALRYKDFRCVIRPQPAPPTARGPPLLATGFSETEAVADFAKQMELRGLEDWWKRGMGYSTDGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.58
4 0.63
5 0.68
6 0.69
7 0.73
8 0.76
9 0.78
10 0.81
11 0.79
12 0.78
13 0.75
14 0.7
15 0.66
16 0.59
17 0.48
18 0.4
19 0.35
20 0.25
21 0.2
22 0.17
23 0.14
24 0.1
25 0.1
26 0.08
27 0.07
28 0.08
29 0.07
30 0.05
31 0.05
32 0.06
33 0.07
34 0.06
35 0.05
36 0.1
37 0.1
38 0.1
39 0.09
40 0.08
41 0.08
42 0.08
43 0.08
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.07
53 0.08
54 0.11
55 0.14
56 0.15
57 0.23
58 0.28
59 0.29
60 0.31
61 0.36
62 0.4
63 0.46
64 0.48
65 0.43
66 0.45
67 0.48
68 0.45
69 0.42
70 0.42
71 0.35
72 0.36
73 0.34
74 0.28
75 0.24
76 0.26
77 0.24
78 0.18
79 0.17
80 0.17
81 0.16
82 0.15
83 0.14
84 0.1
85 0.1
86 0.1
87 0.09
88 0.06
89 0.06
90 0.06
91 0.06
92 0.08
93 0.08
94 0.08
95 0.11
96 0.12
97 0.13
98 0.14
99 0.15
100 0.21
101 0.25
102 0.26
103 0.25
104 0.24
105 0.23
106 0.25
107 0.28
108 0.24