Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3C6M9

Protein Details
Accession S3C6M9    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
89-113LRAVPKKKTSHMKKRHRQMAGKALRBasic
118-140LCQCPACGRTKRQHHVCPHCMESHydrophilic
NLS Segment(s)
PositionSequence
93-108PKKKTSHMKKRHRQMA
Subcellular Location(s) mito 16.5, mito_nucl 11.5, nucl 5.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAAAPLRTAFSAAALLPRLAAPQTSASATAAVSASLTSTIVSSSLISLRTFRAASLFARQIAATPYLPAFSIAFPSISSFLEGIWESVLRAVPKKKTSHMKKRHRQMAGKALRDVKALCQCPACGRTKRQHHVCPHCMESIREMLKKST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.12
5 0.12
6 0.11
7 0.11
8 0.1
9 0.11
10 0.13
11 0.13
12 0.14
13 0.13
14 0.13
15 0.13
16 0.12
17 0.1
18 0.08
19 0.07
20 0.06
21 0.06
22 0.05
23 0.06
24 0.04
25 0.04
26 0.05
27 0.05
28 0.05
29 0.05
30 0.06
31 0.07
32 0.08
33 0.08
34 0.1
35 0.1
36 0.13
37 0.12
38 0.11
39 0.12
40 0.12
41 0.13
42 0.17
43 0.17
44 0.15
45 0.16
46 0.16
47 0.15
48 0.15
49 0.16
50 0.1
51 0.1
52 0.09
53 0.09
54 0.09
55 0.09
56 0.08
57 0.06
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.08
64 0.07
65 0.08
66 0.06
67 0.06
68 0.07
69 0.07
70 0.07
71 0.06
72 0.06
73 0.05
74 0.06
75 0.08
76 0.07
77 0.11
78 0.15
79 0.2
80 0.26
81 0.29
82 0.35
83 0.45
84 0.55
85 0.62
86 0.69
87 0.75
88 0.79
89 0.87
90 0.89
91 0.87
92 0.83
93 0.8
94 0.8
95 0.78
96 0.72
97 0.66
98 0.61
99 0.54
100 0.49
101 0.41
102 0.37
103 0.37
104 0.35
105 0.32
106 0.3
107 0.29
108 0.33
109 0.38
110 0.39
111 0.37
112 0.43
113 0.51
114 0.6
115 0.69
116 0.73
117 0.77
118 0.8
119 0.84
120 0.84
121 0.81
122 0.74
123 0.69
124 0.62
125 0.55
126 0.48
127 0.46
128 0.45
129 0.41