Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3C7A2

Protein Details
Accession S3C7A2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-86ELLRNSKDKRARKLAKKRLGTFGRBasic
NLS Segment(s)
PositionSequence
67-90NSKDKRARKLAKKRLGTFGRAKRK
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAKEAAPRTGLAVGLNKGFKTTARVVKPRVSRTKGHLSKRTAFVRDIVKEVAGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRAKRKVDELTRVITESRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.19
4 0.19
5 0.19
6 0.18
7 0.2
8 0.25
9 0.3
10 0.36
11 0.42
12 0.45
13 0.53
14 0.6
15 0.63
16 0.65
17 0.61
18 0.57
19 0.59
20 0.66
21 0.66
22 0.67
23 0.66
24 0.62
25 0.64
26 0.67
27 0.65
28 0.56
29 0.48
30 0.44
31 0.42
32 0.37
33 0.33
34 0.26
35 0.21
36 0.18
37 0.18
38 0.14
39 0.08
40 0.07
41 0.05
42 0.06
43 0.07
44 0.08
45 0.08
46 0.08
47 0.08
48 0.1
49 0.15
50 0.21
51 0.27
52 0.3
53 0.37
54 0.37
55 0.43
56 0.51
57 0.53
58 0.54
59 0.59
60 0.65
61 0.69
62 0.8
63 0.83
64 0.85
65 0.87
66 0.83
67 0.82
68 0.76
69 0.72
70 0.71
71 0.71
72 0.72
73 0.68
74 0.66
75 0.6
76 0.62
77 0.62
78 0.59
79 0.58
80 0.51
81 0.5
82 0.5
83 0.48
84 0.43