FuNGI

S3CV51

Protein Details

Accession

S3CV51

Localization Confidence

Medium

Confidence Score

14.3

NoLS Segment(s)

Position	Sequence	Protein Nature
457-484	WRNSNQDPRLRSRRVRRMAKMGSRKAAN	Hydrophilic

NLS Segment(s)

Position	Sequence
467-480	RSRRVRRMAKMGSR

Subcellular Location(s)

nucl 25.5, cyto_nucl 15

Family & Domain DBs

Gene Ontology	GO:0005840 C:ribosome

Amino Acid Sequences

MGLMAQQHQQPSLQAKEEPYDHHNQHTPQGQVQNIQQHSRPPSVVHQQPSHPPPQPQQPSYSSVYQPPQQSSGQHPQDIYNYPSSQYNAPATNSGYTSAEMMAATMSRPPYPPMPYHTPQSNSPASVGSASGHDQQRSMYGQPPMHQQQMYYGQHQQYHQQLPPAAPSPYGQHTHPSHQSMGSQPSMMMSHGAPSPVPHQMAQHPGQHSPAPGMNGSPRHTKIEVPQLSRQAPPSAPSPLSMGQVQPNMQPQGMHQGLQSHQTHQPQSMHQPPPHQQHPQHPQHQQHQQHQHIQHQHQQHPQQSAPQHAQHPQHPQQHSAHTPQNGTSPLPSGQTGSAGSSVVNANAAPGPIPATTPLVVRQDQNGVQWIAFEYSRDRVKMEYTIRCDVESVQTDELSAEFKQDNCVYPRACCPREQYRGNRLQYESECNTVGWALAQLNPPLRGKRGLIQRAVDSWRNSNQDPRLRSRRVRRMAKMGSRKAANVANSSGMAAGIGQPSPAHMGPSATLPSVGTPMGKPLHGIPQMHHHTDATAQAGGEEVGMFHQM

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.31
2	0.33
3	0.37
4	0.39
5	0.39
6	0.39
7	0.43
8	0.42
9	0.45
10	0.49
11	0.46
12	0.5
13	0.52
14	0.49
15	0.46
16	0.5
17	0.46
18	0.43
19	0.46
20	0.48
21	0.46
22	0.46
23	0.42
24	0.43
25	0.47
26	0.47
27	0.43
28	0.37
29	0.41
30	0.47
31	0.52
32	0.52
33	0.51
34	0.52
35	0.6
36	0.62
37	0.62
38	0.58
39	0.56
40	0.55
41	0.61
42	0.66
43	0.59
44	0.6
45	0.56
46	0.56
47	0.55
48	0.54
49	0.46
50	0.43
51	0.45
52	0.44
53	0.45
54	0.42
55	0.42
56	0.39
57	0.39
58	0.41
59	0.46
60	0.46
61	0.44
62	0.42
63	0.4
64	0.43
65	0.44
66	0.39
67	0.35
68	0.3
69	0.29
70	0.31
71	0.31
72	0.28
73	0.28
74	0.28
75	0.25
76	0.26
77	0.27
78	0.26
79	0.26
80	0.24
81	0.22
82	0.19
83	0.16
84	0.16
85	0.13
86	0.12
87	0.1
88	0.09
89	0.08
90	0.07
91	0.06
92	0.08
93	0.1
94	0.1
95	0.12
96	0.14
97	0.19
98	0.23
99	0.26
100	0.31
101	0.38
102	0.4
103	0.45
104	0.48
105	0.47
106	0.46
107	0.49
108	0.44
109	0.37
110	0.34
111	0.29
112	0.24
113	0.21
114	0.18
115	0.12
116	0.11
117	0.13
118	0.18
119	0.2
120	0.2
121	0.19
122	0.19
123	0.22
124	0.23
125	0.22
126	0.21
127	0.24
128	0.26
129	0.27
130	0.35
131	0.36
132	0.38
133	0.37
134	0.31
135	0.32
136	0.39
137	0.4
138	0.35
139	0.37
140	0.35
141	0.38
142	0.39
143	0.38
144	0.36
145	0.39
146	0.36
147	0.35
148	0.34
149	0.31
150	0.34
151	0.32
152	0.25
153	0.2
154	0.19
155	0.19
156	0.21
157	0.23
158	0.2
159	0.24
160	0.27
161	0.32
162	0.37
163	0.36
164	0.33
165	0.32
166	0.33
167	0.3
168	0.31
169	0.25
170	0.21
171	0.17
172	0.17
173	0.16
174	0.15
175	0.12
176	0.08
177	0.09
178	0.09
179	0.1
180	0.09
181	0.09
182	0.11
183	0.14
184	0.15
185	0.13
186	0.15
187	0.18
188	0.24
189	0.26
190	0.29
191	0.27
192	0.27
193	0.28
194	0.28
195	0.25
196	0.21
197	0.19
198	0.15
199	0.13
200	0.14
201	0.15
202	0.17
203	0.2
204	0.24
205	0.24
206	0.26
207	0.27
208	0.28
209	0.29
210	0.36
211	0.39
212	0.38
213	0.4
214	0.41
215	0.42
216	0.42
217	0.39
218	0.31
219	0.26
220	0.23
221	0.22
222	0.2
223	0.18
224	0.18
225	0.19
226	0.17
227	0.19
228	0.17
229	0.16
230	0.15
231	0.16
232	0.16
233	0.15
234	0.17
235	0.16
236	0.16
237	0.15
238	0.12
239	0.19
240	0.19
241	0.18
242	0.15
243	0.16
244	0.17
245	0.23
246	0.24
247	0.18
248	0.22
249	0.25
250	0.26
251	0.26
252	0.27
253	0.23
254	0.29
255	0.34
256	0.35
257	0.34
258	0.38
259	0.41
260	0.45
261	0.48
262	0.48
263	0.42
264	0.46
265	0.55
266	0.58
267	0.59
268	0.59
269	0.6
270	0.62
271	0.68
272	0.65
273	0.63
274	0.64
275	0.61
276	0.63
277	0.6
278	0.59
279	0.57
280	0.54
281	0.52
282	0.5
283	0.51
284	0.5
285	0.52
286	0.5
287	0.46
288	0.44
289	0.43
290	0.37
291	0.37
292	0.34
293	0.32
294	0.3
295	0.33
296	0.35
297	0.35
298	0.42
299	0.45
300	0.49
301	0.47
302	0.48
303	0.45
304	0.47
305	0.46
306	0.42
307	0.39
308	0.33
309	0.33
310	0.3
311	0.3
312	0.26
313	0.23
314	0.18
315	0.16
316	0.14
317	0.15
318	0.14
319	0.12
320	0.11
321	0.12
322	0.11
323	0.1
324	0.09
325	0.08
326	0.08
327	0.08
328	0.08
329	0.07
330	0.07
331	0.06
332	0.06
333	0.06
334	0.06
335	0.05
336	0.05
337	0.07
338	0.06
339	0.07
340	0.07
341	0.09
342	0.09
343	0.1
344	0.13
345	0.16
346	0.17
347	0.17
348	0.18
349	0.2
350	0.21
351	0.21
352	0.22
353	0.18
354	0.17
355	0.16
356	0.15
357	0.13
358	0.12
359	0.11
360	0.1
361	0.14
362	0.17
363	0.17
364	0.17
365	0.17
366	0.19
367	0.25
368	0.3
369	0.32
370	0.35
371	0.4
372	0.4
373	0.39
374	0.37
375	0.31
376	0.3
377	0.27
378	0.24
379	0.2
380	0.19
381	0.19
382	0.18
383	0.17
384	0.13
385	0.1
386	0.1
387	0.1
388	0.1
389	0.15
390	0.17
391	0.2
392	0.22
393	0.27
394	0.25
395	0.27
396	0.35
397	0.4
398	0.4
399	0.4
400	0.44
401	0.48
402	0.56
403	0.63
404	0.63
405	0.64
406	0.72
407	0.72
408	0.71
409	0.63
410	0.61
411	0.55
412	0.54
413	0.46
414	0.39
415	0.36
416	0.3
417	0.29
418	0.22
419	0.19
420	0.11
421	0.1
422	0.08
423	0.11
424	0.14
425	0.16
426	0.19
427	0.22
428	0.25
429	0.25
430	0.27
431	0.27
432	0.27
433	0.32
434	0.4
435	0.44
436	0.46
437	0.47
438	0.46
439	0.48
440	0.51
441	0.49
442	0.42
443	0.4
444	0.41
445	0.43
446	0.43
447	0.45
448	0.49
449	0.51
450	0.54
451	0.59
452	0.62
453	0.65
454	0.73
455	0.76
456	0.78
457	0.81
458	0.85
459	0.83
460	0.84
461	0.85
462	0.86
463	0.86
464	0.83
465	0.8
466	0.73
467	0.66
468	0.61
469	0.55
470	0.48
471	0.41
472	0.35
473	0.3
474	0.27
475	0.26
476	0.21
477	0.16
478	0.12
479	0.09
480	0.09
481	0.08
482	0.08
483	0.08
484	0.08
485	0.09
486	0.13
487	0.13
488	0.13
489	0.12
490	0.14
491	0.14
492	0.18
493	0.19
494	0.15
495	0.15
496	0.14
497	0.14
498	0.15
499	0.15
500	0.13
501	0.11
502	0.17
503	0.19
504	0.18
505	0.19
506	0.2
507	0.29
508	0.32
509	0.33
510	0.29
511	0.38
512	0.45
513	0.46
514	0.45
515	0.36
516	0.32
517	0.33
518	0.34
519	0.26
520	0.2
521	0.17
522	0.15
523	0.15
524	0.14
525	0.12
526	0.09
527	0.06

S3CV51

3D AlphaFold-predicted Structure Viewer