Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3BYU2

Protein Details
Accession S3BYU2    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
300-337GTTNAGSKTRIKQKRDRRKYKDNFRYHIQKQPRKPPLRHydrophilic
NLS Segment(s)
PositionSequence
307-337KTRIKQKRDRRKYKDNFRYHIQKQPRKPPLR
Subcellular Location(s) nucl 18.5, cyto_nucl 14.333, cyto 7, cyto_mito 4.999
Family & Domain DBs
Amino Acid Sequences MASPFLENSSMEGLHIFSNVELHINPACLIVSRPDDEESRASSSRNDSIRPLPPQHPFVTENPNQTIESLSETYGEVETDEWILFLEAYGLKQNDVDPEEAGRAADATNILRSPEYLFDHADGITTAFNRLGNATECYEWDDQEDLSVDKEKDADPRTNTSTITDTSTAVDGSDICRTAPVSVLALVHTAERGDSIRQSMREVEVARLTGSSVDTDALGNIVTGIAPGTSTGEITNTRPNMRYGTAVVVGDGTGYDTDTNVMVRTGDSTVSSNTGTTATTTDANAAVGLMTSTSTGSRAGTTNAGSKTRIKQKRDRRKYKDNFRYHIQKQPRKPPLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.11
4 0.08
5 0.09
6 0.09
7 0.11
8 0.1
9 0.12
10 0.13
11 0.13
12 0.13
13 0.12
14 0.12
15 0.11
16 0.13
17 0.14
18 0.17
19 0.18
20 0.2
21 0.22
22 0.24
23 0.26
24 0.28
25 0.27
26 0.28
27 0.27
28 0.26
29 0.27
30 0.31
31 0.35
32 0.35
33 0.33
34 0.32
35 0.38
36 0.44
37 0.47
38 0.48
39 0.48
40 0.5
41 0.53
42 0.51
43 0.49
44 0.46
45 0.43
46 0.46
47 0.45
48 0.44
49 0.42
50 0.42
51 0.37
52 0.34
53 0.31
54 0.22
55 0.22
56 0.18
57 0.15
58 0.14
59 0.14
60 0.15
61 0.13
62 0.12
63 0.08
64 0.07
65 0.08
66 0.08
67 0.07
68 0.06
69 0.06
70 0.06
71 0.06
72 0.05
73 0.06
74 0.06
75 0.07
76 0.11
77 0.11
78 0.11
79 0.11
80 0.12
81 0.14
82 0.16
83 0.16
84 0.12
85 0.13
86 0.14
87 0.13
88 0.13
89 0.09
90 0.07
91 0.06
92 0.06
93 0.07
94 0.06
95 0.08
96 0.08
97 0.09
98 0.08
99 0.09
100 0.1
101 0.13
102 0.15
103 0.15
104 0.15
105 0.16
106 0.17
107 0.16
108 0.14
109 0.11
110 0.09
111 0.08
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.09
119 0.1
120 0.11
121 0.12
122 0.12
123 0.12
124 0.16
125 0.16
126 0.14
127 0.14
128 0.12
129 0.11
130 0.11
131 0.11
132 0.07
133 0.08
134 0.11
135 0.1
136 0.09
137 0.11
138 0.11
139 0.16
140 0.19
141 0.22
142 0.21
143 0.25
144 0.28
145 0.28
146 0.28
147 0.24
148 0.23
149 0.19
150 0.19
151 0.16
152 0.13
153 0.12
154 0.13
155 0.11
156 0.09
157 0.08
158 0.06
159 0.06
160 0.07
161 0.06
162 0.06
163 0.06
164 0.07
165 0.07
166 0.07
167 0.07
168 0.06
169 0.07
170 0.07
171 0.07
172 0.07
173 0.07
174 0.06
175 0.06
176 0.05
177 0.04
178 0.05
179 0.05
180 0.06
181 0.06
182 0.09
183 0.12
184 0.13
185 0.14
186 0.15
187 0.15
188 0.18
189 0.18
190 0.17
191 0.16
192 0.15
193 0.14
194 0.13
195 0.12
196 0.09
197 0.08
198 0.07
199 0.06
200 0.06
201 0.06
202 0.06
203 0.06
204 0.05
205 0.05
206 0.04
207 0.04
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.04
216 0.05
217 0.05
218 0.05
219 0.07
220 0.09
221 0.11
222 0.17
223 0.18
224 0.2
225 0.22
226 0.23
227 0.25
228 0.24
229 0.24
230 0.2
231 0.2
232 0.2
233 0.19
234 0.17
235 0.14
236 0.12
237 0.1
238 0.09
239 0.06
240 0.04
241 0.05
242 0.05
243 0.05
244 0.05
245 0.06
246 0.06
247 0.06
248 0.06
249 0.06
250 0.06
251 0.08
252 0.08
253 0.08
254 0.09
255 0.11
256 0.11
257 0.13
258 0.13
259 0.11
260 0.11
261 0.11
262 0.1
263 0.1
264 0.1
265 0.1
266 0.11
267 0.11
268 0.12
269 0.11
270 0.11
271 0.1
272 0.09
273 0.07
274 0.06
275 0.05
276 0.04
277 0.04
278 0.04
279 0.05
280 0.05
281 0.06
282 0.07
283 0.08
284 0.1
285 0.11
286 0.13
287 0.15
288 0.17
289 0.22
290 0.26
291 0.27
292 0.28
293 0.33
294 0.4
295 0.48
296 0.55
297 0.56
298 0.63
299 0.72
300 0.81
301 0.87
302 0.89
303 0.88
304 0.91
305 0.94
306 0.95
307 0.94
308 0.93
309 0.88
310 0.86
311 0.87
312 0.81
313 0.8
314 0.8
315 0.79
316 0.79
317 0.84