Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3CUL0

Protein Details
Accession S3CUL0    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-45ASDARIKKSKKTSQTKFKVRCKRNLYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREVGDIKQFIEICRREDASDARIKKSKKTSQTKFKVRCKRNLYTLVLKDSDKADKLKQSLPPNLTCTEVNKKIKKTSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.31
4 0.27
5 0.3
6 0.32
7 0.29
8 0.35
9 0.34
10 0.34
11 0.39
12 0.39
13 0.43
14 0.49
15 0.52
16 0.54
17 0.62
18 0.67
19 0.73
20 0.82
21 0.85
22 0.85
23 0.87
24 0.87
25 0.82
26 0.82
27 0.78
28 0.73
29 0.7
30 0.67
31 0.62
32 0.6
33 0.57
34 0.51
35 0.45
36 0.41
37 0.35
38 0.3
39 0.28
40 0.22
41 0.22
42 0.22
43 0.25
44 0.28
45 0.32
46 0.37
47 0.41
48 0.47
49 0.49
50 0.49
51 0.48
52 0.46
53 0.44
54 0.38
55 0.37
56 0.38
57 0.43
58 0.49
59 0.53
60 0.57