Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3BPG5

Protein Details
Accession S3BPG5    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
19-42WKVPWRLSPFQKYRQRQRLRAVDSHydrophilic
79-106KYTMFDRKAKRYRKGIHKLPKWTRVSQRHydrophilic
NLS Segment(s)
PositionSequence
85-99RKAKRYRKGIHKLPK
Subcellular Location(s) mito 23, cyto_nucl 2, nucl 1.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGLGAFRSTSPLSGGLLWKVPWRLSPFQKYRQRQRLRAVDSVVDTLSTALAKQGMAMKSIERWKTEMPREEEMLPRDKYTMFDRKAKRYRKGIHKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.15
4 0.16
5 0.17
6 0.19
7 0.2
8 0.19
9 0.22
10 0.27
11 0.32
12 0.38
13 0.48
14 0.51
15 0.59
16 0.69
17 0.73
18 0.78
19 0.81
20 0.82
21 0.8
22 0.82
23 0.82
24 0.77
25 0.72
26 0.63
27 0.54
28 0.46
29 0.4
30 0.3
31 0.2
32 0.14
33 0.1
34 0.08
35 0.06
36 0.05
37 0.04
38 0.04
39 0.04
40 0.05
41 0.09
42 0.09
43 0.1
44 0.11
45 0.11
46 0.14
47 0.2
48 0.21
49 0.18
50 0.2
51 0.23
52 0.3
53 0.35
54 0.39
55 0.39
56 0.4
57 0.41
58 0.41
59 0.41
60 0.37
61 0.37
62 0.31
63 0.27
64 0.25
65 0.23
66 0.23
67 0.26
68 0.33
69 0.3
70 0.38
71 0.44
72 0.53
73 0.62
74 0.69
75 0.71
76 0.71
77 0.77
78 0.8
79 0.84
80 0.84
81 0.86
82 0.85
83 0.88
84 0.87
85 0.87
86 0.82
87 0.8
88 0.8
89 0.79
90 0.8
91 0.77
92 0.79