Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3C7Y1

Protein Details
Accession S3C7Y1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
55-74KSFRTKQKLAKAQKQNRPIPHydrophilic
80-101RTGNTIRYNAKRRHWRKTRLNIHydrophilic
NLS Segment(s)
PositionSequence
90-96KRRHWRK
Subcellular Location(s) nucl 14.5, cyto_nucl 11.833, cyto 6, cyto_pero 4.999, pero 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MDDMDDTDENDGIGYGNGNDTNNNGDERHKLDQTSARPSFGTTTSSTQLELLSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.07
4 0.08
5 0.09
6 0.09
7 0.1
8 0.12
9 0.13
10 0.14
11 0.13
12 0.14
13 0.17
14 0.22
15 0.25
16 0.24
17 0.23
18 0.25
19 0.31
20 0.33
21 0.39
22 0.35
23 0.32
24 0.3
25 0.31
26 0.29
27 0.23
28 0.22
29 0.15
30 0.17
31 0.18
32 0.18
33 0.17
34 0.15
35 0.15
36 0.12
37 0.11
38 0.12
39 0.12
40 0.12
41 0.12
42 0.16
43 0.21
44 0.29
45 0.37
46 0.4
47 0.45
48 0.54
49 0.64
50 0.69
51 0.74
52 0.76
53 0.77
54 0.79
55 0.82
56 0.8
57 0.78
58 0.75
59 0.73
60 0.68
61 0.67
62 0.68
63 0.62
64 0.61
65 0.57
66 0.54
67 0.53
68 0.55
69 0.55
70 0.5
71 0.52
72 0.53
73 0.58
74 0.64
75 0.64
76 0.67
77 0.7
78 0.73
79 0.78
80 0.82
81 0.84