Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3BWA1

Protein Details
Accession S3BWA1    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-48KDGQSKSKNKSKSKIKNKSSSSSHydrophilic
NLS Segment(s)
PositionSequence
31-45KSKNKSKSKIKNKSS
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences MSSRSTSPSHKFSKSNDSKNDHLYGKDGQSKSKNKSKSKIKNKSSSSSHAARPPSPMVNRASLTPTGSPKTPRKNRSPSLGSPTPKGFYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.65
3 0.66
4 0.65
5 0.64
6 0.65
7 0.65
8 0.55
9 0.46
10 0.4
11 0.34
12 0.33
13 0.37
14 0.32
15 0.33
16 0.39
17 0.46
18 0.49
19 0.53
20 0.58
21 0.56
22 0.65
23 0.7
24 0.73
25 0.77
26 0.81
27 0.82
28 0.82
29 0.8
30 0.78
31 0.72
32 0.66
33 0.6
34 0.53
35 0.48
36 0.43
37 0.41
38 0.34
39 0.33
40 0.31
41 0.31
42 0.29
43 0.29
44 0.27
45 0.29
46 0.28
47 0.26
48 0.27
49 0.22
50 0.23
51 0.22
52 0.24
53 0.22
54 0.24
55 0.3
56 0.35
57 0.45
58 0.53
59 0.58
60 0.65
61 0.72
62 0.76
63 0.79
64 0.78
65 0.74
66 0.73
67 0.74
68 0.67
69 0.62
70 0.6