Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PEY7

Protein Details
Accession A0A1D8PEY7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
92-119VKNTPIKSESKRKNKPGKKFGAKKRSWVHydrophilic
NLS Segment(s)
PositionSequence
99-116SESKRKNKPGKKFGAKKR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR003656  Znf_BED  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
KEGG cal:CAALFM_C110410WA  -  
PROSITE View protein in PROSITE  
PS50808  ZF_BED  
Amino Acid Sequences MNNSFISKASPDHSSATVISGESHLQQQQQHHQNELDTVVTAAQLQQLKQGTSNKPLPTEQEQKNTILTQQHVSSSQQHHTFMEPLSQSSLVKNTPIKSESKRKNKPGKKFGAKKRSWVWTWFDQDLHDTNIAKCTYCNKVIIRFASDKGSPKKLLEHLKTHKININSINFARPVPIDGTGMTYSSSGQPLSQPSHNGIKKEPGSNQTHTSQLSDLSLQLASSRDTDNKESLNGTSGPGQPFNSSRFRINVVKFLTENKLSMDVLKSNSFRQLVYDLRPESVNDISEVTSMYDAFLECTRYSPAEPGNTDSNLRVNGSNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.23
4 0.21
5 0.18
6 0.16
7 0.15
8 0.15
9 0.13
10 0.17
11 0.17
12 0.19
13 0.23
14 0.28
15 0.37
16 0.45
17 0.46
18 0.47
19 0.46
20 0.44
21 0.42
22 0.37
23 0.27
24 0.18
25 0.16
26 0.12
27 0.1
28 0.09
29 0.08
30 0.11
31 0.13
32 0.12
33 0.17
34 0.2
35 0.2
36 0.25
37 0.33
38 0.32
39 0.38
40 0.45
41 0.42
42 0.43
43 0.44
44 0.45
45 0.45
46 0.5
47 0.48
48 0.5
49 0.5
50 0.48
51 0.49
52 0.44
53 0.39
54 0.34
55 0.3
56 0.26
57 0.24
58 0.25
59 0.24
60 0.26
61 0.29
62 0.29
63 0.33
64 0.32
65 0.32
66 0.32
67 0.32
68 0.32
69 0.25
70 0.26
71 0.2
72 0.18
73 0.19
74 0.19
75 0.17
76 0.16
77 0.19
78 0.14
79 0.17
80 0.2
81 0.19
82 0.23
83 0.25
84 0.28
85 0.33
86 0.43
87 0.49
88 0.57
89 0.64
90 0.7
91 0.8
92 0.83
93 0.87
94 0.87
95 0.87
96 0.87
97 0.88
98 0.88
99 0.88
100 0.81
101 0.78
102 0.74
103 0.71
104 0.62
105 0.57
106 0.52
107 0.48
108 0.51
109 0.45
110 0.39
111 0.32
112 0.32
113 0.29
114 0.25
115 0.19
116 0.16
117 0.14
118 0.18
119 0.18
120 0.16
121 0.15
122 0.16
123 0.19
124 0.2
125 0.23
126 0.2
127 0.25
128 0.29
129 0.3
130 0.3
131 0.28
132 0.27
133 0.27
134 0.27
135 0.29
136 0.29
137 0.32
138 0.29
139 0.27
140 0.3
141 0.33
142 0.4
143 0.38
144 0.42
145 0.44
146 0.52
147 0.52
148 0.51
149 0.48
150 0.41
151 0.4
152 0.37
153 0.34
154 0.28
155 0.27
156 0.27
157 0.23
158 0.22
159 0.19
160 0.13
161 0.12
162 0.1
163 0.1
164 0.09
165 0.09
166 0.12
167 0.11
168 0.11
169 0.1
170 0.09
171 0.09
172 0.09
173 0.1
174 0.07
175 0.07
176 0.08
177 0.11
178 0.14
179 0.15
180 0.16
181 0.18
182 0.28
183 0.29
184 0.29
185 0.28
186 0.32
187 0.34
188 0.36
189 0.37
190 0.35
191 0.39
192 0.4
193 0.43
194 0.37
195 0.36
196 0.33
197 0.31
198 0.24
199 0.19
200 0.17
201 0.13
202 0.12
203 0.1
204 0.09
205 0.08
206 0.08
207 0.08
208 0.08
209 0.09
210 0.11
211 0.13
212 0.17
213 0.2
214 0.21
215 0.21
216 0.22
217 0.21
218 0.2
219 0.2
220 0.17
221 0.16
222 0.18
223 0.21
224 0.21
225 0.22
226 0.22
227 0.21
228 0.23
229 0.26
230 0.28
231 0.27
232 0.28
233 0.28
234 0.32
235 0.38
236 0.38
237 0.41
238 0.37
239 0.38
240 0.36
241 0.38
242 0.38
243 0.32
244 0.3
245 0.25
246 0.25
247 0.21
248 0.23
249 0.22
250 0.19
251 0.21
252 0.26
253 0.26
254 0.25
255 0.31
256 0.3
257 0.27
258 0.26
259 0.28
260 0.27
261 0.3
262 0.36
263 0.31
264 0.32
265 0.33
266 0.3
267 0.29
268 0.27
269 0.23
270 0.16
271 0.17
272 0.16
273 0.15
274 0.15
275 0.13
276 0.11
277 0.1
278 0.09
279 0.09
280 0.08
281 0.1
282 0.11
283 0.13
284 0.13
285 0.15
286 0.18
287 0.19
288 0.2
289 0.23
290 0.27
291 0.31
292 0.32
293 0.35
294 0.37
295 0.38
296 0.38
297 0.35
298 0.34
299 0.29
300 0.29