Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DTU1

Protein Details
Accession B0DTU1    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MFGRRRNKRRIYLAFFHREFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto_nucl 6, nucl 5, cyto 5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_332824  -  
Amino Acid Sequences MFGRRRNKRRIYLAFFHREFTPDNPIKYHTAFLVTPKRPNSISEAKNSRIFHVRKDLSNGREERWIFDPKPTRTRSYLLAGVMLLGKVPNAISADALETIFECVPRLTAPRDNPRWLCRDWIWSALPILVAENVIKPLPSAPNEVWKAGLAFTEAQNVPMLFNAIPCCDALGRRIASEIGPLVKNPTVKDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.75
3 0.68
4 0.58
5 0.49
6 0.43
7 0.37
8 0.38
9 0.33
10 0.34
11 0.34
12 0.36
13 0.38
14 0.37
15 0.35
16 0.25
17 0.24
18 0.23
19 0.28
20 0.35
21 0.35
22 0.39
23 0.4
24 0.43
25 0.4
26 0.41
27 0.41
28 0.41
29 0.41
30 0.44
31 0.47
32 0.48
33 0.53
34 0.52
35 0.48
36 0.47
37 0.45
38 0.4
39 0.45
40 0.44
41 0.39
42 0.46
43 0.5
44 0.43
45 0.5
46 0.47
47 0.39
48 0.42
49 0.4
50 0.36
51 0.33
52 0.36
53 0.29
54 0.34
55 0.41
56 0.39
57 0.48
58 0.48
59 0.48
60 0.45
61 0.46
62 0.43
63 0.38
64 0.36
65 0.28
66 0.25
67 0.21
68 0.18
69 0.16
70 0.12
71 0.07
72 0.04
73 0.04
74 0.03
75 0.03
76 0.04
77 0.04
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.06
84 0.05
85 0.04
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.06
93 0.08
94 0.1
95 0.15
96 0.22
97 0.31
98 0.35
99 0.41
100 0.44
101 0.46
102 0.47
103 0.42
104 0.41
105 0.33
106 0.35
107 0.31
108 0.31
109 0.29
110 0.25
111 0.25
112 0.2
113 0.19
114 0.13
115 0.11
116 0.07
117 0.07
118 0.06
119 0.06
120 0.07
121 0.07
122 0.06
123 0.06
124 0.08
125 0.12
126 0.13
127 0.18
128 0.18
129 0.27
130 0.29
131 0.29
132 0.28
133 0.25
134 0.23
135 0.19
136 0.18
137 0.11
138 0.1
139 0.1
140 0.16
141 0.15
142 0.16
143 0.17
144 0.17
145 0.15
146 0.14
147 0.16
148 0.09
149 0.11
150 0.12
151 0.11
152 0.12
153 0.12
154 0.13
155 0.12
156 0.13
157 0.13
158 0.19
159 0.19
160 0.19
161 0.2
162 0.2
163 0.19
164 0.21
165 0.22
166 0.19
167 0.19
168 0.19
169 0.22
170 0.25
171 0.27