Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3C429

Protein Details
Accession S3C429    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPANTGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
8-23AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 7, cyto 7, cyto_nucl 7, pero 7, cyto_pero 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPANTGAKKQKKKWSKGKVKDKAQHAVILDKLTSEKLYKDVQSYRLVTVATLVDRLKINGSLARKCLTDLEEKGQIKQIVGHSKMKIYTRAIGDAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.89
4 0.9
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.48
15 0.39
16 0.32
17 0.25
18 0.18
19 0.16
20 0.13
21 0.13
22 0.1
23 0.09
24 0.11
25 0.14
26 0.15
27 0.18
28 0.2
29 0.23
30 0.27
31 0.27
32 0.25
33 0.23
34 0.22
35 0.18
36 0.16
37 0.13
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.1
47 0.12
48 0.16
49 0.17
50 0.19
51 0.2
52 0.19
53 0.19
54 0.21
55 0.2
56 0.23
57 0.23
58 0.25
59 0.32
60 0.33
61 0.33
62 0.37
63 0.35
64 0.29
65 0.3
66 0.32
67 0.33
68 0.36
69 0.41
70 0.37
71 0.4
72 0.44
73 0.43
74 0.42
75 0.37
76 0.4
77 0.37