Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CEW7

Protein Details
Accession S3CEW7   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-110MKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKNERRGEGETBasic
NLS Segment(s)
PositionSequence
2-105KKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKNERR
Subcellular Location(s) nucl 14, mito 13
Family & Domain DBs
Amino Acid Sequences MKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKKMKNERRGEGETGAIYHGQSRIDDSTLASLFCTIQLFYHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.95
4 0.94
5 0.94
6 0.95
7 0.94
8 0.94
9 0.95
10 0.94
11 0.94
12 0.95
13 0.94
14 0.94
15 0.95
16 0.94
17 0.94
18 0.95
19 0.94
20 0.94
21 0.95
22 0.94
23 0.94
24 0.95
25 0.94
26 0.94
27 0.95
28 0.94
29 0.94
30 0.95
31 0.94
32 0.94
33 0.95
34 0.94
35 0.94
36 0.95
37 0.94
38 0.94
39 0.95
40 0.94
41 0.94
42 0.95
43 0.94
44 0.94
45 0.95
46 0.94
47 0.94
48 0.95
49 0.94
50 0.94
51 0.95
52 0.94
53 0.94
54 0.95
55 0.94
56 0.94
57 0.95
58 0.94
59 0.94
60 0.95
61 0.94
62 0.94
63 0.95
64 0.94
65 0.94
66 0.95
67 0.94
68 0.94
69 0.95
70 0.94
71 0.94
72 0.95
73 0.94
74 0.94
75 0.95
76 0.94
77 0.94
78 0.95
79 0.94
80 0.94
81 0.95
82 0.94
83 0.94
84 0.93
85 0.93
86 0.93
87 0.93
88 0.92
89 0.91
90 0.85
91 0.82
92 0.76
93 0.69
94 0.59
95 0.5
96 0.39
97 0.31
98 0.26
99 0.19
100 0.14
101 0.12
102 0.12
103 0.11
104 0.11
105 0.14
106 0.15
107 0.15
108 0.16
109 0.15
110 0.18
111 0.18
112 0.18
113 0.14
114 0.13
115 0.12
116 0.13
117 0.13
118 0.09