Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3BXX6

Protein Details
Accession S3BXX6   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
100-122ITNGNVPKRKKKVHRKITFEEWIHydrophilic
NLS Segment(s)
PositionSequence
106-115PKRKKKVHRK
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MSRPLTPGSEPPVASNGSTRQHSYHHDDIHTDSDSEPAIEPVSEPVTRSLSEPPPSLPDIYDNENCLNDIVLPSVEPDDRDVDTPGASASISHKRKAEMITNGNVPKRKKKVHRKITFEEWIVEEVARRRAQYATPEPVNETDDSSTEPPSTSSDGSPRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.25
4 0.25
5 0.28
6 0.28
7 0.27
8 0.3
9 0.35
10 0.4
11 0.42
12 0.41
13 0.4
14 0.39
15 0.4
16 0.4
17 0.35
18 0.28
19 0.21
20 0.18
21 0.17
22 0.15
23 0.13
24 0.1
25 0.09
26 0.08
27 0.08
28 0.08
29 0.11
30 0.11
31 0.11
32 0.13
33 0.14
34 0.15
35 0.16
36 0.19
37 0.22
38 0.24
39 0.25
40 0.24
41 0.25
42 0.26
43 0.25
44 0.2
45 0.18
46 0.17
47 0.21
48 0.21
49 0.2
50 0.19
51 0.19
52 0.19
53 0.16
54 0.13
55 0.08
56 0.07
57 0.06
58 0.05
59 0.05
60 0.05
61 0.06
62 0.06
63 0.06
64 0.07
65 0.08
66 0.09
67 0.1
68 0.1
69 0.09
70 0.09
71 0.09
72 0.08
73 0.06
74 0.05
75 0.05
76 0.08
77 0.17
78 0.19
79 0.21
80 0.22
81 0.23
82 0.26
83 0.29
84 0.32
85 0.3
86 0.32
87 0.33
88 0.37
89 0.4
90 0.4
91 0.42
92 0.39
93 0.41
94 0.45
95 0.51
96 0.57
97 0.65
98 0.73
99 0.79
100 0.86
101 0.85
102 0.84
103 0.84
104 0.8
105 0.7
106 0.61
107 0.51
108 0.42
109 0.34
110 0.27
111 0.21
112 0.17
113 0.22
114 0.21
115 0.2
116 0.21
117 0.22
118 0.25
119 0.32
120 0.36
121 0.38
122 0.39
123 0.4
124 0.41
125 0.41
126 0.4
127 0.32
128 0.27
129 0.2
130 0.18
131 0.22
132 0.2
133 0.2
134 0.18
135 0.18
136 0.16
137 0.18
138 0.21
139 0.19
140 0.21