Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0E1H1

Protein Details
Accession B0E1H1    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
41-63RIVSFRKGAKRKKQLTEWRKNEIHydrophilic
NLS Segment(s)
PositionSequence
47-53KGAKRKK
Subcellular Location(s) nucl 14, mito_nucl 11.333, cyto_nucl 9.833, mito 7.5, cyto 4.5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_316710  -  
Amino Acid Sequences MTPLSHLPFERRANFYEGSICPTKWSRSQMVVNATMSLMARIVSFRKGAKRKKQLTEWRKNEISTNLRPPQSTPPSCLQSRRLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.36
4 0.29
5 0.3
6 0.29
7 0.26
8 0.25
9 0.27
10 0.29
11 0.29
12 0.33
13 0.31
14 0.34
15 0.38
16 0.39
17 0.41
18 0.4
19 0.35
20 0.3
21 0.26
22 0.21
23 0.17
24 0.12
25 0.08
26 0.05
27 0.05
28 0.05
29 0.06
30 0.07
31 0.08
32 0.11
33 0.19
34 0.28
35 0.37
36 0.47
37 0.57
38 0.64
39 0.7
40 0.78
41 0.8
42 0.83
43 0.85
44 0.81
45 0.78
46 0.73
47 0.66
48 0.6
49 0.57
50 0.53
51 0.49
52 0.52
53 0.5
54 0.49
55 0.49
56 0.48
57 0.5
58 0.53
59 0.49
60 0.45
61 0.46
62 0.51
63 0.54
64 0.57