Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3D2Y9

Protein Details
Accession S3D2Y9   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
130-150AEWEKRKDNTAQRPRGRPKGSBasic
NLS Segment(s)
PositionSequence
57-60GRGR
142-149RPRGRPKG
Subcellular Location(s) cyto 10.5, cyto_pero 9, pero 6.5, nucl 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MDVPTPPPIVPPEPIRRNGFQFDGAFKTIDGVAFERPQHLLRLCYPSEPEKWKIKLGRGRPPKMEKITDLEAARTLSRKFMLAQFRFYGIPPPYQSSSDEVLGIFQEQVTQGNFRKMAADVEALRDEMAAEWEKRKDNTAQRPRGRPKGSTRKNDDALPASIVGEYHITSKEIQDQWSVNGNLALHIAATSTTGVFKGTFHFGVILGVMILSADEKQLIAHVRRLDAGDDPDRRNADDLSAGGKRKQPPNGAVRRGDMQQLVGGKKARTGGPQPTVGGPGLAPIGGMPGMGGIPGMPGMGAPNMGANMGITGLGALVGNPMGMTGTPTGHTVTHTPDLVPPTPASPVLLHTGSRPPLKFYVRWRGRGLINDHLQTGEHRGTFKFTNKHYTKFSGEMDLAFLGADEIVGKRISSVPTLSGEAWSDYMETVYDWRSGNRWN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.58
4 0.61
5 0.61
6 0.55
7 0.5
8 0.46
9 0.43
10 0.42
11 0.39
12 0.33
13 0.28
14 0.27
15 0.22
16 0.2
17 0.17
18 0.14
19 0.16
20 0.2
21 0.21
22 0.21
23 0.22
24 0.23
25 0.27
26 0.28
27 0.28
28 0.3
29 0.37
30 0.35
31 0.36
32 0.39
33 0.38
34 0.44
35 0.46
36 0.47
37 0.48
38 0.5
39 0.55
40 0.57
41 0.61
42 0.62
43 0.65
44 0.69
45 0.71
46 0.75
47 0.77
48 0.79
49 0.79
50 0.78
51 0.74
52 0.66
53 0.62
54 0.59
55 0.55
56 0.47
57 0.39
58 0.33
59 0.3
60 0.28
61 0.25
62 0.21
63 0.19
64 0.19
65 0.19
66 0.19
67 0.25
68 0.34
69 0.33
70 0.38
71 0.36
72 0.37
73 0.37
74 0.35
75 0.35
76 0.27
77 0.3
78 0.27
79 0.31
80 0.31
81 0.32
82 0.33
83 0.3
84 0.31
85 0.26
86 0.24
87 0.19
88 0.17
89 0.16
90 0.15
91 0.1
92 0.07
93 0.07
94 0.07
95 0.08
96 0.09
97 0.13
98 0.14
99 0.19
100 0.19
101 0.19
102 0.2
103 0.19
104 0.19
105 0.17
106 0.19
107 0.14
108 0.17
109 0.18
110 0.16
111 0.15
112 0.14
113 0.12
114 0.09
115 0.11
116 0.1
117 0.11
118 0.14
119 0.18
120 0.21
121 0.22
122 0.25
123 0.3
124 0.37
125 0.47
126 0.54
127 0.61
128 0.66
129 0.76
130 0.8
131 0.82
132 0.77
133 0.72
134 0.72
135 0.73
136 0.75
137 0.75
138 0.75
139 0.73
140 0.72
141 0.68
142 0.6
143 0.52
144 0.44
145 0.35
146 0.27
147 0.19
148 0.17
149 0.14
150 0.11
151 0.08
152 0.07
153 0.07
154 0.08
155 0.08
156 0.09
157 0.1
158 0.16
159 0.17
160 0.18
161 0.19
162 0.19
163 0.2
164 0.26
165 0.25
166 0.18
167 0.18
168 0.17
169 0.14
170 0.14
171 0.12
172 0.05
173 0.05
174 0.05
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.05
182 0.05
183 0.05
184 0.07
185 0.09
186 0.09
187 0.09
188 0.09
189 0.09
190 0.09
191 0.09
192 0.06
193 0.04
194 0.03
195 0.03
196 0.02
197 0.02
198 0.02
199 0.02
200 0.03
201 0.03
202 0.03
203 0.03
204 0.05
205 0.08
206 0.09
207 0.12
208 0.13
209 0.14
210 0.15
211 0.16
212 0.15
213 0.13
214 0.16
215 0.18
216 0.21
217 0.22
218 0.24
219 0.25
220 0.24
221 0.24
222 0.2
223 0.15
224 0.12
225 0.11
226 0.11
227 0.14
228 0.15
229 0.16
230 0.2
231 0.25
232 0.29
233 0.34
234 0.35
235 0.39
236 0.48
237 0.54
238 0.55
239 0.52
240 0.49
241 0.46
242 0.42
243 0.38
244 0.28
245 0.2
246 0.16
247 0.18
248 0.17
249 0.17
250 0.18
251 0.16
252 0.18
253 0.2
254 0.19
255 0.19
256 0.24
257 0.28
258 0.29
259 0.31
260 0.3
261 0.28
262 0.28
263 0.24
264 0.2
265 0.13
266 0.09
267 0.08
268 0.07
269 0.06
270 0.04
271 0.04
272 0.04
273 0.04
274 0.03
275 0.03
276 0.03
277 0.03
278 0.03
279 0.02
280 0.02
281 0.03
282 0.03
283 0.02
284 0.02
285 0.03
286 0.04
287 0.04
288 0.04
289 0.04
290 0.05
291 0.05
292 0.05
293 0.04
294 0.04
295 0.04
296 0.04
297 0.03
298 0.03
299 0.03
300 0.03
301 0.03
302 0.03
303 0.03
304 0.03
305 0.03
306 0.03
307 0.03
308 0.03
309 0.03
310 0.05
311 0.05
312 0.06
313 0.07
314 0.08
315 0.1
316 0.1
317 0.12
318 0.12
319 0.16
320 0.18
321 0.18
322 0.18
323 0.2
324 0.24
325 0.24
326 0.24
327 0.2
328 0.18
329 0.19
330 0.19
331 0.17
332 0.13
333 0.14
334 0.17
335 0.17
336 0.16
337 0.17
338 0.23
339 0.26
340 0.31
341 0.3
342 0.3
343 0.36
344 0.4
345 0.43
346 0.46
347 0.52
348 0.54
349 0.59
350 0.59
351 0.58
352 0.57
353 0.59
354 0.56
355 0.54
356 0.52
357 0.48
358 0.44
359 0.39
360 0.36
361 0.29
362 0.3
363 0.24
364 0.2
365 0.2
366 0.21
367 0.25
368 0.29
369 0.36
370 0.37
371 0.37
372 0.47
373 0.49
374 0.54
375 0.56
376 0.57
377 0.54
378 0.52
379 0.5
380 0.45
381 0.41
382 0.36
383 0.32
384 0.26
385 0.21
386 0.16
387 0.13
388 0.08
389 0.06
390 0.06
391 0.05
392 0.05
393 0.07
394 0.07
395 0.07
396 0.09
397 0.13
398 0.15
399 0.17
400 0.18
401 0.19
402 0.22
403 0.25
404 0.24
405 0.22
406 0.22
407 0.2
408 0.19
409 0.17
410 0.15
411 0.12
412 0.12
413 0.1
414 0.09
415 0.1
416 0.12
417 0.15
418 0.15
419 0.17