Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3D2H3

Protein Details
Accession S3D2H3   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
28-53VIATRTPSEHRCRRDRRHVAWRLIDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MALASSSHDMPRPPSSLYSSHGTQSSTVIATRTPSEHRCRRDRRHVAWRLIDSSEETPSTASSDSGIAPAELVNTRTASLQSCGQTASSLQQDRLASPTAYSAQLAGTTAEGTLGTSNTLGRSPWAVPLNNASHHNAPADRTRQQDEQRETSERQTEASDRTQDREFTHPSLYPLEPRYQPPQRRPTPPGVPSFEAAQQSLESRLALRRRGAMDGGPGGHADANGSAGAGNRGSFSFST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.33
4 0.35
5 0.36
6 0.32
7 0.33
8 0.32
9 0.3
10 0.26
11 0.24
12 0.22
13 0.18
14 0.17
15 0.15
16 0.13
17 0.15
18 0.16
19 0.18
20 0.21
21 0.27
22 0.36
23 0.44
24 0.52
25 0.6
26 0.69
27 0.76
28 0.81
29 0.85
30 0.84
31 0.87
32 0.88
33 0.85
34 0.82
35 0.76
36 0.68
37 0.58
38 0.5
39 0.42
40 0.34
41 0.28
42 0.21
43 0.17
44 0.14
45 0.13
46 0.14
47 0.11
48 0.09
49 0.08
50 0.09
51 0.09
52 0.09
53 0.09
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.08
60 0.08
61 0.08
62 0.09
63 0.1
64 0.1
65 0.1
66 0.11
67 0.14
68 0.14
69 0.14
70 0.14
71 0.14
72 0.13
73 0.12
74 0.13
75 0.15
76 0.15
77 0.15
78 0.18
79 0.19
80 0.19
81 0.2
82 0.19
83 0.14
84 0.13
85 0.14
86 0.12
87 0.12
88 0.11
89 0.09
90 0.07
91 0.07
92 0.08
93 0.06
94 0.05
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.05
106 0.05
107 0.05
108 0.05
109 0.07
110 0.07
111 0.11
112 0.14
113 0.14
114 0.14
115 0.19
116 0.21
117 0.21
118 0.23
119 0.21
120 0.19
121 0.2
122 0.2
123 0.16
124 0.16
125 0.19
126 0.22
127 0.23
128 0.25
129 0.28
130 0.33
131 0.38
132 0.45
133 0.45
134 0.46
135 0.46
136 0.47
137 0.45
138 0.43
139 0.42
140 0.33
141 0.29
142 0.26
143 0.24
144 0.24
145 0.26
146 0.28
147 0.25
148 0.28
149 0.29
150 0.3
151 0.3
152 0.32
153 0.31
154 0.27
155 0.29
156 0.27
157 0.27
158 0.29
159 0.27
160 0.26
161 0.25
162 0.28
163 0.27
164 0.3
165 0.37
166 0.43
167 0.5
168 0.55
169 0.63
170 0.65
171 0.71
172 0.73
173 0.73
174 0.73
175 0.71
176 0.68
177 0.64
178 0.58
179 0.52
180 0.49
181 0.43
182 0.35
183 0.3
184 0.23
185 0.18
186 0.17
187 0.18
188 0.16
189 0.12
190 0.12
191 0.19
192 0.22
193 0.26
194 0.27
195 0.31
196 0.33
197 0.36
198 0.36
199 0.31
200 0.31
201 0.3
202 0.28
203 0.23
204 0.2
205 0.18
206 0.17
207 0.15
208 0.11
209 0.08
210 0.08
211 0.07
212 0.07
213 0.07
214 0.07
215 0.09
216 0.09
217 0.09
218 0.09
219 0.1