Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3CAA8

Protein Details
Accession S3CAA8    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-41DRPSAYFDGRRRRRDHRQREPEPEVPABasic
168-191RERELERERERRDRERNRNGGGRDBasic
NLS Segment(s)
PositionSequence
172-192LERERERRDRERNRNGGGRDR
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027157  NCBP2  
IPR034148  NCBP2_RRM  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0005846  C:nuclear cap binding complex  
GO:0005634  C:nucleus  
GO:0000339  F:RNA cap binding  
GO:0045292  P:mRNA cis splicing, via spliceosome  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12240  RRM_NCBP2  
Amino Acid Sequences MATAFEPRSTVDRLDRPSAYFDGRRRRRDHRQREPEPEVPAEDPLADAATLYVGNLSFYTTEEQVYELFSKCGEIKRLIMGLDRFNKTPCGFCFVEYYTHQDALDCMKYVGGTKLDERIIRTDLDPGFEEGRQYGRGKSGGQVRDEYRDDYDEGRGGLGRAIQMERERERELERERERRDRERNRNGGGRDRERERDYRNDDYDDIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.41
4 0.43
5 0.42
6 0.4
7 0.4
8 0.43
9 0.48
10 0.55
11 0.62
12 0.64
13 0.71
14 0.76
15 0.81
16 0.85
17 0.85
18 0.87
19 0.87
20 0.9
21 0.89
22 0.82
23 0.75
24 0.66
25 0.57
26 0.47
27 0.39
28 0.29
29 0.21
30 0.16
31 0.12
32 0.1
33 0.07
34 0.06
35 0.05
36 0.05
37 0.05
38 0.04
39 0.05
40 0.04
41 0.05
42 0.05
43 0.05
44 0.05
45 0.06
46 0.09
47 0.09
48 0.09
49 0.09
50 0.1
51 0.09
52 0.11
53 0.11
54 0.1
55 0.1
56 0.09
57 0.1
58 0.11
59 0.14
60 0.16
61 0.15
62 0.16
63 0.18
64 0.19
65 0.18
66 0.2
67 0.18
68 0.21
69 0.26
70 0.26
71 0.25
72 0.25
73 0.28
74 0.25
75 0.27
76 0.22
77 0.22
78 0.2
79 0.21
80 0.23
81 0.21
82 0.24
83 0.21
84 0.27
85 0.22
86 0.22
87 0.21
88 0.17
89 0.17
90 0.16
91 0.16
92 0.1
93 0.09
94 0.08
95 0.08
96 0.09
97 0.1
98 0.08
99 0.09
100 0.09
101 0.12
102 0.14
103 0.15
104 0.16
105 0.16
106 0.17
107 0.16
108 0.16
109 0.18
110 0.16
111 0.17
112 0.17
113 0.16
114 0.16
115 0.15
116 0.15
117 0.11
118 0.13
119 0.14
120 0.14
121 0.13
122 0.14
123 0.16
124 0.16
125 0.2
126 0.26
127 0.27
128 0.28
129 0.31
130 0.3
131 0.35
132 0.36
133 0.33
134 0.27
135 0.25
136 0.24
137 0.22
138 0.22
139 0.17
140 0.15
141 0.14
142 0.12
143 0.11
144 0.1
145 0.1
146 0.09
147 0.09
148 0.1
149 0.12
150 0.15
151 0.21
152 0.23
153 0.27
154 0.28
155 0.29
156 0.32
157 0.36
158 0.39
159 0.44
160 0.49
161 0.54
162 0.58
163 0.66
164 0.7
165 0.73
166 0.78
167 0.79
168 0.81
169 0.83
170 0.85
171 0.83
172 0.83
173 0.79
174 0.78
175 0.76
176 0.74
177 0.71
178 0.68
179 0.69
180 0.66
181 0.69
182 0.65
183 0.65
184 0.64
185 0.65
186 0.63
187 0.6