Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3BX22

Protein Details
Accession S3BX22    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-38GHGHRHRHGGHHRHSRHNRHKSHSNHNSBasic
NLS Segment(s)
PositionSequence
20-26GHHRHSR
82-91KKNKHRKRRR
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences MGHYEYTHSYGHGHRHRHGGHHRHSRHNRHKSHSNHNSAVDNWNAFFKDYSSEYKDGFYVGPPKKSLICRFFSCIFGSSSSKKNKHRKRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.48
3 0.49
4 0.55
5 0.62
6 0.61
7 0.64
8 0.69
9 0.72
10 0.74
11 0.82
12 0.84
13 0.85
14 0.85
15 0.82
16 0.79
17 0.83
18 0.79
19 0.8
20 0.79
21 0.75
22 0.68
23 0.63
24 0.57
25 0.49
26 0.45
27 0.34
28 0.25
29 0.18
30 0.15
31 0.13
32 0.11
33 0.1
34 0.08
35 0.09
36 0.11
37 0.14
38 0.18
39 0.19
40 0.19
41 0.2
42 0.19
43 0.18
44 0.16
45 0.14
46 0.19
47 0.21
48 0.24
49 0.24
50 0.26
51 0.3
52 0.36
53 0.42
54 0.39
55 0.42
56 0.42
57 0.47
58 0.47
59 0.45
60 0.41
61 0.34
62 0.29
63 0.27
64 0.29
65 0.27
66 0.33
67 0.41
68 0.47
69 0.56
70 0.65
71 0.73